DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and Tlr4

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_062051.1 Gene:Tlr4 RGDID:3870 Length:835 Species:Rattus norvegicus

Alignment Length:867 Identity:210/868 (24%)
Similarity:332/868 (38%) Gaps:233/868 (27%)


  Fly   305 VPL----ATLPSRLFANQPELQILRLRAELQSLPGDL---FEHSTQITNISLGDNLLKTLPATLL 362
            :||    .||...||     |..||        ||.|   .|....||...:..||.|      :
  Rat     2 MPLLHLAGTLIMALF-----LSCLR--------PGSLNPCIEVLPNITYQCMDQNLSK------I 47

  Fly   363 EHQV--NLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNR 425
            .|.:  :..:||||.|.|..|....|.:.:.|..|.|....:..|....:..|..|.|||::.|.
  Rat    48 PHDIPYSTKNLDLSFNPLKILRSYSFTNFSQLQWLDLSRCEIETIEDKAWHGLNQLSTLVLTGNP 112

  Fly   426 LRTIDSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQINSPFGYMHG----LLTLNLRNNSI- 485
            :::....:|.....|.:|               :.::|::.|..|:..|    |..||:.:|.| 
  Rat   113 IKSFSPGSFSGLTNLENL---------------VAVETKMTSLEGFHIGQLISLKKLNVAHNLIH 162

  Fly   486 IFVYNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQN-------------------------RL 525
            .|...::.:.:..|..:|||||.|.::..:||.||.:|                         ||
  Rat   163 SFKLPEYFSNLTNLEHVDLSYNYIQTISVKDLQFLRENPQVNLSLDLSLNPIDSIQAQAFQGIRL 227

  Fly   526 H------------------VNMTHNKIRRIALPE----------DVHLGEGYNN------NLVHV 556
            |                  .|||...:.|:.|.|          |..:.||..|      .|.::
  Rat   228 HELTLRSNFNSSNVLKMCLQNMTGLHVHRLILGEFKNERNLESFDRSVMEGLCNVSIDEFRLTYI 292

  Fly   557 D-LNDNPLVCDCTILWFIQLVRGVHKPQYS---RQFKLRTDRLV-C--------SQPNVLEGTPV 608
            : .:|:....:|..........|||....:   |.||.::..:: |        |.|.:...|..
  Rat   293 NHFSDDIYNLNCLANISAMSFTGVHIKHIADVPRHFKWQSLSIIRCHLKPFPKLSLPFLKSWTLT 357

  Fly   609 RQIEP----QTLICPLDFSDDPRERKCPRGCNCHVR------------TYDKALVINCHSGNLTH 657
            ...|.    |..:..|.:.|..|.....||| |...            :::..::::.:...|..
  Rat   358 TNREDISFGQLALPSLRYLDLSRNAMSFRGC-CSYSDFGTNNLKYLDLSFNGVILMSANFMGLEE 421

  Fly   658 VPRLPNLHKNMQLME-----LHLENNTLLRLPSANTP--------GYESVTSLHLAGNNL---TS 706
            :..|...|..::.:.     |.||....|.:...||.        |..|:.:|.:|||:.   |.
  Rat   422 LEYLDFQHSTLKKVTEFSVFLSLEKLLYLDISYTNTKIDFDGIFLGLISLNTLKMAGNSFKDNTL 486

  Fly   707 IDVDQLPTNLTHLDIS--------------WNHLQMLN--------------------------- 730
            .:|....||||.||:|              ...||:||                           
  Rat   487 SNVFTNTTNLTFLDLSKCQLEQISRGVFDTLYRLQLLNMSHNNLLFLDPSHYKQLYSLRTLDCSF 551

  Fly   731 ---ATVLGFLNRTMKWRSV-KLSGNPWMCDCTAKPLLLFTQDNFERIGDRNEMMCVN-AEMPTRM 790
               .|..|.|....|..:| .|:.|...|.|..:..|.:.:|....:.:..:|.|.: .:|...:
  Rat   552 NRIETSKGILQHFPKSLAVFNLTNNSVACICEYQNFLQWVKDQKMFLVNVEQMKCASPIDMKASL 616

  Fly   791 VELSTNDICPAEKGVFIALAVVIALTGLLAGFTAALYYKFQTEIKIWLYAHNLLL----WFVTEE 851
            |...||..|...|.: |:::||   :.|:....|.|.|.|        |.|.:|:    .:...|
  Rat   617 VLDFTNSTCYIYKTI-ISVSVV---SVLVVATVAFLIYHF--------YFHLILIAGCKKYSRGE 669

  Fly   852 DLDKDKKFDAFISYSHKDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVGGHIPENIMR-SVADSR 915
            .:     :|||:.||.:::.::.:.||..||.|..:||||:|.||::.|..|..||:: ....||
  Rat   670 SI-----YDAFVIYSSQNEDWVRNELVKNLEEGVPRFQLCLHYRDFIPGVAIAANIIQEGFHKSR 729

  Fly   916 RTIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGDVEK--LDEELKAY--LKMNT 976
            :.|:|:|::||:|.|...|:..|........||.||.|:   :..|||  |.::::.|  |..||
  Rat   730 KVIVVVSRHFIQSRWCIFEYEIAQTWQFLSSRSGIIFIV---LEKVEKSLLRQQVELYRLLSRNT 791

  Fly   977 YLKW-----GDPWFWDKLRFAL 993
            ||:|     |...||.:|:.||
  Rat   792 YLEWEDNALGRHIFWRRLKKAL 813

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566
leucine-rich repeat 176..198 CDD:275380
leucine-rich repeat 199..222 CDD:275380
LRR_RI 216..542 CDD:238064 71/304 (23%)
LRR_8 221..281 CDD:290566
leucine-rich repeat 223..270 CDD:275380
leucine-rich repeat 271..294 CDD:275380
leucine-rich repeat 295..320 CDD:275380 6/19 (32%)
leucine-rich repeat 321..343 CDD:275380 7/25 (28%)
LRR_8 342..402 CDD:290566 17/62 (27%)
leucine-rich repeat 344..367 CDD:275380 6/25 (24%)
leucine-rich repeat 368..391 CDD:275380 8/23 (35%)
LRR_8 390..450 CDD:290566 13/60 (22%)
leucine-rich repeat 392..415 CDD:275380 5/23 (22%)
leucine-rich repeat 416..439 CDD:275380 6/23 (26%)
leucine-rich repeat 440..474 CDD:275380 5/34 (15%)
leucine-rich repeat 475..498 CDD:275380 6/24 (25%)
LRR_8 477..534 CDD:290566 23/101 (23%)
leucine-rich repeat 499..520 CDD:275380 10/21 (48%)
leucine-rich repeat 523..552 CDD:275380 14/88 (16%)
LRRCT 561..619 CDD:214507 13/74 (18%)
LRRNT 631..667 CDD:214470 7/48 (15%)
leucine-rich repeat 664..693 CDD:275380 8/42 (19%)
LRR_8 669..726 CDD:290566 21/87 (24%)
leucine-rich repeat 694..715 CDD:275380 7/24 (29%)
leucine-rich repeat 716..737 CDD:275380 11/65 (17%)
LRRCT 751..800 CDD:214507 12/50 (24%)
TIR 858..996 CDD:214587 54/147 (37%)
Tlr4NP_062051.1 LRR 1 54..75 8/21 (38%)
LRR_8 56..113 CDD:290566 18/57 (32%)
leucine-rich repeat 58..78 CDD:275380 8/20 (40%)
LRR 2 78..99 4/21 (19%)
leucine-rich repeat 79..102 CDD:275380 5/23 (22%)
LRR 3 102..123 6/21 (29%)
leucine-rich repeat 103..126 CDD:275380 6/23 (26%)
LRR 4 126..147 6/36 (17%)
leucine-rich repeat 127..150 CDD:275380 6/38 (16%)
LRR_8 150..214 CDD:290566 18/64 (28%)
LRR 5 150..171 6/21 (29%)
leucine-rich repeat 151..175 CDD:275380 6/24 (25%)
LRR 6 175..198 11/23 (48%)
leucine-rich repeat 176..204 CDD:275380 12/28 (43%)
LRR 7 204..224 0/20 (0%)
leucine-rich repeat 205..226 CDD:275380 0/21 (0%)
LRR 8 226..247 3/21 (14%)
leucine-rich repeat 256..310 CDD:275380 10/54 (19%)
LRR_RI <369..555 CDD:238064 35/187 (19%)
LRR 9 372..381 3/9 (33%)
leucine-rich repeat 373..398 CDD:275380 7/26 (27%)
LRR 10 398..420 1/22 (5%)
leucine-rich repeat 399..421 CDD:275380 1/22 (5%)
LRR 11 421..442 2/21 (10%)
leucine-rich repeat 422..446 CDD:275380 5/24 (21%)
LRR 12 446..467 3/21 (14%)
leucine-rich repeat 447..470 CDD:275380 4/23 (17%)
LRR 13 470..491 7/21 (33%)
leucine-rich repeat 471..495 CDD:275380 7/24 (29%)
LRR_8 494..554 CDD:290566 11/60 (18%)
LRR 14 495..516 6/21 (29%)
leucine-rich repeat 496..519 CDD:275380 5/23 (22%)
LRR 15 519..540 4/21 (19%)
leucine-rich repeat 520..543 CDD:275380 4/23 (17%)
LRR 16 543..564 3/21 (14%)
leucine-rich repeat 544..567 CDD:275380 4/23 (17%)
TIR 672..813 CDD:214587 53/144 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.