DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and Tlr13

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_991389.1 Gene:Tlr13 MGIID:3045213 Length:991 Species:Mus musculus

Alignment Length:1026 Identity:244/1027 (24%)
Similarity:386/1027 (38%) Gaps:282/1027 (27%)


  Fly   134 SDNLGMN-ITRQHLDRLHGL---KRFRFTTRRLTHIPANLLTDMRNLSHLELRAN-IEEMPSHLF 193
            ::..|.| .|:...|..|.|   |:....|..::.||       |..:||.|..| |:.:|...|
Mouse    66 AETYGFNKCTQYEFDIHHVLCIRKKITNLTEAISDIP-------RYTTHLNLTHNEIQVLPPWSF 123

  Fly   194 DDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIE 258
            .:|..|..:....|.:.::..|.|..:..|..|||..|::.:: .:.|||.:|:..:.:..|.|.
Mouse   124 TNLSALVDLRLEWNSIWKIDEGAFRGLENLTLLNLVENKIQSV-NNSFEGLSSLKTLLLSHNQIT 187

  Fly   259 QLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKH---LNEVRLMNNRVPLATLPSRLFANQPE 320
            .:..|.|..|..:..::||.|..... .|:.:..:|   |..:.|.||.:.......|...:...
Mouse   188 HIHKDAFTPLIKLKYLSLSRNNISDF-SGILEAVQHLPCLERLDLTNNSIMYLDHSPRSLVSLTH 251

  Fly   321 L-----QILRLRAELQSLPGDLFEHSTQITNISLGDN--------LLKTLP--------ATLL-- 362
            |     ::..|.....|||        .:||:|...|        .|||||        .|::  
Mouse   252 LSFEGNKLRELNFSALSLP--------NLTNLSASRNGNKVIQNVYLKTLPQLKSLNLSGTVIKL 308

  Fly   363 -----EHQVNLLSLDLSNNRLTH------------------------------------------ 380
                 :|..||.::||||..|.|                                          
Mouse   309 ENLSAKHLQNLRAMDLSNWELRHGHLDMKTVCHLLGNLPKLETLVFQKNVTNAEGIKQLAKCTRL 373

  Fly   381 -------------LPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTIDSR 432
                         |.||.|....:|..|.|....|:.|:...:|:|.||.:|.:|.|:.::....
Mouse   374 LFLDLGQNSDLIYLNDSEFNALPSLQKLNLNKCQLSFINNRTWSSLQNLTSLDLSHNKFKSFPDF 438

  Fly   433 AFVSTNGLRHLHLDHNDID-------------------------------LQQPLLDIM------ 460
            ||.....|..|.|..|.|.                               .|.|.|:::      
Mouse   439 AFSPLKHLEFLSLSRNPITELNNLAFSGLFALKELNLAACWIVTIDRYSFTQFPNLEVLDLGDNN 503

  Fly   461 LQTQINSPFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYNNISSL------GYEDLAF 519
            ::|..:..|..:..|.:|.|.:|.:..:..:..:.:..||.|||.||::|..      |.|.|..
Mouse   504 IRTLNHGTFRPLKKLQSLILSHNCLKILEPNSFSGLTNLRSLDLMYNSLSYFHEHLFSGLEKLLI 568

  Fly   520 LSQNRLHVN-MTHNKIRRIALPEDVHLG-------EGYNNNLVHVDLNDNPLVCDCTILWFIQLV 576
            |   :|..| :|:...|.:..|..:.|.       ||..:.:..|..|            |.|  
Mouse   569 L---KLGFNKITYETTRTLQYPPFIKLKSLKQLNLEGQRHGIQVVPSN------------FFQ-- 616

  Fly   577 RGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRT 641
             |:...|         :.|:...|:|.  ....|.:|...:..||.|.              .:.
Mouse   617 -GLGSLQ---------ELLLGKNPSVF--LDHHQFDPLINLTKLDISG--------------TKD 655

  Fly   642 YDKALVINCHSGNLTHVPRLPNLHKNMQLME-LHLENNTLLRLPSANTPGYESVTSLHLAGNNLT 705
            .|::|.:|.            :|.:|::.:: |.||||.|..|........:|:....|..|||.
Mouse   656 GDRSLYLNA------------SLFQNLKRLKILRLENNNLESLVPDMFSSLQSLQVFSLRFNNLK 708

  Fly   706 SIDVDQLPT--NLTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLSGNPWM----CDCTAKPLLL 764
            .|:...|..  :|...|:..|.|| .....|.|.|.:|....|.:   |::    |.......||
Mouse   709 VINQSHLKNLKSLMFFDVYGNKLQ-CTCDNLWFKNWSMNTEEVHI---PFLRSYPCQQPGSQSLL 769

  Fly   765 FTQDNFERIGDRNEMMCVNAEMPTRMVELSTNDICPAEKGVFIALAVVIALTGLLAGFT----AA 825
            .         |.::.|| |.::               .|..|:....::..|.:.:.|:    |:
Mouse   770 I---------DFDDAMC-NFDL---------------GKVYFLCSFSMVLSTMVFSWFSTKMIAS 809

  Fly   826 LYYKFQTEIKIWLY---AHNLLLWFVTEEDLDKDKKF--DAFISYSHKDQSFIEDYLVPQLEHGP 885
            |:|        .||   |..|..|..||      |||  |||:|:|..|::::...|||.||.|.
Mouse   810 LWY--------GLYICRAWYLTKWHKTE------KKFLYDAFVSFSATDEAWVYKELVPALEQGS 860

  Fly   886 Q-KFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGRSR 949
            | .|:||:|:||:..|..|.|||..::..||:|:.|:|.:::.|||.|||.:.|......|.:..
Mouse   861 QTTFKLCLHQRDFEPGIDIFENIQNAINTSRKTLCVVSNHYLHSEWCRLEVQLASMKMFYEHKDV 925

  Fly   950 IIVIIYSDIGDVEKLD--EELKAYLKMNTYLKWGD-----PWFWDKLRFAL 993
            ||:|...:|.:. ||.  ..|:..:...|::.|.|     |.||.::|.||
Mouse   926 IILIFLEEIPNY-KLSSYHRLRKLINKQTFITWPDSVHQQPLFWARIRNAL 975

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 18/60 (30%)
leucine-rich repeat 176..198 CDD:275380 8/23 (35%)
leucine-rich repeat 199..222 CDD:275380 4/23 (17%)
LRR_RI 216..542 CDD:238064 98/456 (21%)
LRR_8 221..281 CDD:290566 17/60 (28%)
leucine-rich repeat 223..270 CDD:275380 14/47 (30%)
leucine-rich repeat 271..294 CDD:275380 4/23 (17%)
leucine-rich repeat 295..320 CDD:275380 5/25 (20%)
leucine-rich repeat 321..343 CDD:275380 5/27 (19%)
LRR_8 342..402 CDD:290566 26/138 (19%)
leucine-rich repeat 344..367 CDD:275380 11/46 (24%)
leucine-rich repeat 368..391 CDD:275380 11/78 (14%)
LRR_8 390..450 CDD:290566 18/60 (30%)
leucine-rich repeat 392..415 CDD:275380 7/23 (30%)
leucine-rich repeat 416..439 CDD:275380 6/23 (26%)
leucine-rich repeat 440..474 CDD:275380 10/71 (14%)
leucine-rich repeat 475..498 CDD:275380 4/23 (17%)
LRR_8 477..534 CDD:290566 18/64 (28%)
leucine-rich repeat 499..520 CDD:275380 11/27 (41%)
leucine-rich repeat 523..552 CDD:275380 8/37 (22%)
LRRCT 561..619 CDD:214507 9/58 (16%)
LRRNT 631..667 CDD:214470 4/36 (11%)
leucine-rich repeat 664..693 CDD:275380 9/30 (30%)
LRR_8 669..726 CDD:290566 17/60 (28%)
leucine-rich repeat 694..715 CDD:275380 6/23 (26%)
leucine-rich repeat 716..737 CDD:275380 7/21 (33%)
LRRCT 751..800 CDD:214507 8/53 (15%)
TIR 858..996 CDD:214587 55/147 (37%)
Tlr13NP_991389.1 LRR 1 104..125 7/21 (33%)
leucine-rich repeat 105..128 CDD:275380 8/23 (35%)
LRR_8 106..163 CDD:290566 17/57 (30%)
LRR 2 128..149 4/21 (19%)
leucine-rich repeat 129..152 CDD:275380 4/23 (17%)
LRR 3 152..174 8/23 (35%)
leucine-rich repeat 153..175 CDD:275380 8/23 (35%)
LRR 4 175..196 5/21 (24%)
leucine-rich repeat 176..199 CDD:275380 5/23 (22%)
LRR_8 183..236 CDD:290566 14/54 (26%)
LRR_RI <192..405 CDD:238064 44/222 (20%)
LRR 5 199..220 4/22 (18%)
leucine-rich repeat 200..225 CDD:275380 5/26 (19%)
LRR 6 225..246 5/21 (24%)
leucine-rich repeat 226..248 CDD:275380 5/22 (23%)
LRR 7 248..268 2/20 (10%)
leucine-rich repeat 249..271 CDD:275380 5/30 (17%)
LRR 8 271..292 6/21 (29%)
leucine-rich repeat 272..295 CDD:275380 9/23 (39%)
LRR 9 295..315 1/20 (5%)
leucine-rich repeat 296..319 CDD:275380 3/23 (13%)
LRR 10 318..338 8/20 (40%)
LRR 11 348..368 0/20 (0%)
LRR 12 372..394 4/22 (18%)
leucine-rich repeat 373..397 CDD:275380 4/24 (17%)
LRR_8 396..456 CDD:290566 18/60 (30%)
LRR 13 397..418 6/21 (29%)
leucine-rich repeat 398..421 CDD:275380 7/23 (30%)
LRR_4 420..463 CDD:289563 12/43 (28%)
LRR 14 421..442 7/21 (33%)
leucine-rich repeat 422..445 CDD:275380 6/23 (26%)
LRR 15 445..466 5/21 (24%)
leucine-rich repeat 446..469 CDD:275380 5/23 (22%)
LRR 16 469..490 0/21 (0%)
leucine-rich repeat 470..493 CDD:275380 2/23 (9%)
LRR_8 492..552 CDD:290566 15/60 (25%)
LRR 17 493..514 3/21 (14%)
leucine-rich repeat 494..517 CDD:275380 3/23 (13%)
LRR 18 517..538 4/21 (19%)
leucine-rich repeat 518..541 CDD:275380 4/23 (17%)
LRR_8 540..602 CDD:290566 19/65 (29%)
LRR 19 541..562 8/21 (38%)
leucine-rich repeat 542..565 CDD:275380 10/23 (43%)
LRR 20 565..585 6/23 (26%)
leucine-rich repeat 566..585 CDD:275380 6/22 (27%)
LRR 21 594..617 6/38 (16%)
LRR 22 620..641 5/32 (16%)
LRR 23 644..665 6/47 (13%)
LRR_8 671..731 CDD:290566 17/60 (28%)
LRR 24 672..693 7/21 (33%)
leucine-rich repeat 673..696 CDD:275380 7/23 (30%)
LRR 25 696..716 7/20 (35%)
leucine-rich repeat 697..718 CDD:275380 6/21 (29%)
TIR 834..976 CDD:214587 53/144 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_134658
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R8923
TreeFam 1 0.960
65.900

Return to query results.
Submit another query.