DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and Tlr11

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_991388.2 Gene:Tlr11 MGIID:3045226 Length:931 Species:Mus musculus

Alignment Length:956 Identity:219/957 (23%)
Similarity:363/957 (38%) Gaps:284/957 (30%)


  Fly   191 HLFDDLENLESIEFGSNKLRQMPRG-----IFGKMPKL--------KQLNLWSNQLH--NLTKHD 240
            ||.....|::::   :..|:::||.     :.|.:|.|        ..|.|...||.  ::|...
Mouse    66 HLLASCSNVKNL---NQTLKRVPRNTEVLCLQGMVPTLPAKAFIRFHSLQLLRLQLRTTSVTSRT 127

  Fly   241 FEGATSVLGIDIHDNGIEQLPHDVF-AHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNR 304
            |:             |::||.:..| .|......:.||.|.|.||        :.|:.:......
Mouse   128 FQ-------------GLDQLQYLFFDHHAPCCLSLFLSPNCFESL--------RSLSSLSFQGYC 171

  Fly   305 VPLAT---LPSRLFANQPELQILRLR-------AELQSLPGDLFEHSTQITNISLGDNLLKTLPA 359
            :..:.   ||:       .|:.|.||       .:||.|..||...::...||..|...|:||..
Mouse   172 LTYSQSIYLPT-------SLRHLTLRNSCLTKFQDLQRLFPDLLLSTSSTPNIKPGAPFLETLDL 229

  Fly   360 --------------------TLLEHQVNLLSLDLSNNRLTHL-------------PDSLFAHTTN 391
                                :|:.....|.:|||:::.|.||             |.||    |.
Mouse   230 SYNLQLKQAGVRDLYGLTLHSLILDGTPLKALDLTDSGLLHLHFLSLVGTGIEKVPASL----TG 290

  Fly   392 LTDLRLED---NLLTGI--SGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDHNDID 451
            .::||..|   |.:..|  :|:| .....|..|.:..|.|:|:.:|...:...|:.|:|..|.:.
Mouse   291 YSELRALDLGKNQIQNILENGEI-PGYKALEFLSLHDNHLQTLPTRFLHTLPQLQKLNLSMNKLG 354

  Fly   452 LQQPLLDIMLQTQINSPFG-YMHGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYE 515
               |:|::        |.| :...|..|:|..|.:..|.:...:.:.||:||.||.||||||..|
Mouse   355 ---PILEL--------PEGLFSTNLKVLDLSYNQLCDVPHGALSLLSQLQELWLSGNNISSLSNE 408

  Fly   516 DLAFLSQNRLHVNMTHNKIRRIALPEDVHLGEGYNNNLVHVDLNDNPLVCDCTIL-WFIQLVRGV 579
            .|..|.|.|. ::::.|:|:        .|..|:.::|        |.:....:| .:::.:.|:
Mouse   409 SLQGLRQLRT-LDLSWNQIK--------VLKPGWLSHL--------PALTTLNLLGTYLEYILGI 456

  Fly   580 --HKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIE---PQTLICPLDFSDDPRERKCPRGCNCHV 639
              ..|:..|..:|.:             .|:..|.   |.||:     |.:.:...|        
Mouse   457 QLQGPKMLRHLQLGS-------------YPILDIYPPWPPTLL-----SLEIQAESC-------- 495

  Fly   640 RTYDKALVINCHSGNLTHVPRLPNLHKNMQLMELHLENNTLLRLPSANTPGYESVTSLHLAG--- 701
                  :....|||.       |.|.    |..|.||.:.||..|...|..:.|:..|.|.|   
Mouse   496 ------IQFMIHSGQ-------PFLF----LENLTLETSILLLKPDNITIHFPSLRRLTLRGYSF 543

  Fly   702 ----NNLTSIDVDQLPTNLTH----------LDISWNHLQMLNATVLGFLN-----RTMKWRSVK 747
                :.|......|||. |.|          :|:....:..|....||:||     .|||...: 
Mouse   544 IFSTSQLQRFFPQQLPL-LEHFFIWCENSYAVDLYLFGMPRLRVLELGYLNFFYESSTMKLEML- 606

  Fly   748 LSGNPWMCDCTAKPLLL--FTQDNFERIGDRNEMMCVNAEMPTRMVELSTN-------------- 796
            |...|.:.......|.|  .:..:|:.:.|. :::..|:|   |.:|:::|              
Mouse   607 LKEVPQLQVLALSHLNLRNLSVSSFKSLQDL-KLLLFNSE---RALEMNSNLQEFIPQMPQYVYF 667

  Fly   797 -DI-----CPA------------------EKGVFIALAVVIALTGLLAGFTA------ALYYKFQ 831
             |:     |.|                  ||.:.||.|...:.| ||..|.|      ..::.|.
Mouse   668 SDVTFTCQCEASWLESWATRAPNTFVYGLEKSICIANASDYSKT-LLFSFLATNCPHGTEFWGFL 731

  Fly   832 TEIKI--------------WLYAHNL------LLWFVTEEDLDKDKKFDAFISYSHKDQSFIEDY 876
            |...:              |.:.|:|      ..|.:....|.....:|.||||..:||:::.:.
Mouse   732 TSFILLLLLIILPLISCPKWSWLHHLWTLFHTCWWKLCGHRLRGQFNYDVFISYCEEDQAWVLEE 796

  Fly   877 LVPQLEHGP---QKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFR-A 937
            |||.||..|   :..:||:..||:.:|....|:::.|:..||.|:.||:...:.|.|..||.| |
Mouse   797 LVPVLEKAPPEGEGLRLCLPARDFGIGNDRMESMIASMGKSRATLCVLTGQALASPWCNLELRLA 861

  Fly   938 AHRSALNEGRSRIIVIIYSDIGDVEKLD-EELKAYLKMNTYLKWGD 982
            .:......|.:.::::.      :|.|| :.|.:|.:::.:|:..|
Mouse   862 TYHLVARPGTTHLLLLF------LEPLDRQRLHSYHRLSRWLQKED 901

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 12/55 (22%)
leucine-rich repeat 176..198 CDD:275380 2/7 (29%)
leucine-rich repeat 199..222 CDD:275380 5/28 (18%)
LRR_RI 216..542 CDD:238064 95/386 (25%)
LRR_8 221..281 CDD:290566 16/71 (23%)
leucine-rich repeat 223..270 CDD:275380 12/58 (21%)
leucine-rich repeat 271..294 CDD:275380 6/23 (26%)
leucine-rich repeat 295..320 CDD:275380 3/28 (11%)
leucine-rich repeat 321..343 CDD:275380 9/29 (31%)
LRR_8 342..402 CDD:290566 22/96 (23%)
leucine-rich repeat 344..367 CDD:275380 7/43 (16%)
leucine-rich repeat 368..391 CDD:275380 11/36 (31%)
LRR_8 390..450 CDD:290566 18/65 (28%)
leucine-rich repeat 392..415 CDD:275380 7/28 (25%)
leucine-rich repeat 416..439 CDD:275380 6/23 (26%)
leucine-rich repeat 440..474 CDD:275380 8/35 (23%)
leucine-rich repeat 475..498 CDD:275380 5/23 (22%)
LRR_8 477..534 CDD:290566 22/57 (39%)
leucine-rich repeat 499..520 CDD:275380 13/21 (62%)
leucine-rich repeat 523..552 CDD:275380 5/29 (17%)
LRRCT 561..619 CDD:214507 11/64 (17%)
LRRNT 631..667 CDD:214470 6/36 (17%)
leucine-rich repeat 664..693 CDD:275380 9/29 (31%)
LRR_8 669..726 CDD:290566 19/74 (26%)
leucine-rich repeat 694..715 CDD:275380 7/28 (25%)
leucine-rich repeat 716..737 CDD:275380 6/31 (19%)
LRRCT 751..800 CDD:214507 12/71 (17%)
TIR 858..996 CDD:214587 39/131 (30%)
Tlr11NP_991388.2 LRR_RI <184..427 CDD:238064 72/260 (28%)
leucine-rich repeat 224..246 CDD:275380 3/22 (14%)
leucine-rich repeat 248..270 CDD:275380 6/22 (27%)
leucine-rich repeat 271..293 CDD:275380 5/26 (19%)
leucine-rich repeat 294..318 CDD:275380 7/25 (28%)
LRR_8 319..378 CDD:290566 18/70 (26%)
leucine-rich repeat 319..342 CDD:275380 6/23 (26%)
leucine-rich repeat 343..367 CDD:275380 8/35 (23%)
LRR_8 366..426 CDD:290566 23/61 (38%)
leucine-rich repeat 368..391 CDD:275380 5/23 (22%)
leucine-rich repeat 392..415 CDD:275380 14/23 (61%)
LRR_8 414..471 CDD:290566 13/74 (18%)
leucine-rich repeat 416..437 CDD:275380 5/30 (17%)
leucine-rich repeat 440..463 CDD:275380 3/23 (13%)
TIR_2 781..>861 CDD:290400 29/80 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.