DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and tol-1

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001020983.1 Gene:tol-1 WormBaseID:WBGene00006593 Length:1221 Species:Caenorhabditis elegans

Alignment Length:1371 Identity:294/1372 (21%)
Similarity:478/1372 (35%) Gaps:505/1372 (37%)


  Fly     9 ELALLVIILQLLQWPGSEASFGRDACSEMSIDGLCQCAPIMSEYEIICPANAENPTFRLTIQPKD 73
            ::.|.:.:|.::....|.|:.| |.|.:     .|:|||           :...||.:|      
 Worm     4 KMKLFLFLLLVINICRSAAANG-DECPK-----FCKCAP-----------DPVQPTSKL------ 45

  Fly    74 YVQIMCNLTDTTDYQQLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLG 138
               ::|      ||..  |...|                ||||| .:|..:.:..:|....||..
 Worm    46 ---LLC------DYSS--KNTTI----------------TPIAS-SNYDQVANIRSLFISCDNNN 82

  Fly   139 MNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLEL-----RANIEEMPSHLFDDLEN 198
            ......:...|..|...|......||....|..|:..|..|||     .:...||...:...|..
 Worm    83 FQFPDAYFKSLTALHHLRIVGCETTHFSVKLFEDLAALRRLELDQISTASTSFEMTEDVLMPLAR 147

  Fly   199 LESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHD 263
            ||......::..::|:.:...:|.|:.||:.||:|.:|.:.:...|..:|.:|:..|        
 Worm   148 LEKFSLTRSRNIELPQRLLCSLPHLQVLNISSNELPSLRREESCVAQQLLIVDLSRN-------- 204

  Fly   264 VFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRV-----PLATLPSRLFANQPELQI 323
               .|||:      ....|.:|.        :.::.:..|.:     .|||         |.||.
 Worm   205 ---RLTNI------EQFLRGIPA--------IRQISVAYNSIAELDLSLAT---------PFLQQ 243

  Fly   324 LRLRA----ELQSLPGDLFEHSTQITNISLGDNLLKTLP------ATLLEHQVN----------- 367
            |...|    :|.||||       .:.:::|..|.||.:|      |:|:...|:           
 Worm   244 LDAEANRIVDLTSLPG-------TVVHVNLAGNALKRVPDAVAELASLVALNVSRNEIEAGNSSV 301

  Fly   368 -----LLSLDLSNNRLTHLP-------DSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLV 420
                 |..||.|.|:|..||       :...||      |.||.|.:..::|.:.:|..||.||.
 Worm   302 FSSPELEMLDASYNKLDSLPVEWLQKCEKRIAH------LHLEHNSIEQLTGGVLANATNLQTLD 360

  Fly   421 MSRNRLRTIDSRAFVSTNGLRHLHLDHNDIDLQQP--LLDIMLQ---------TQINSPFGYMHG 474
            :|.|:||..........:.:.:|.|.:|.::|.:|  |..:.|:         |::.:..|.:..
 Worm   361 LSSNQLRVFRDEVLPENSKIGNLRLSNNSLELLEPSSLSGLKLESLDLSHNKLTEVPAAIGKVEQ 425

  Fly   475 LLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLH------------- 526
            |..::|.:|.|..||....|.:.||..:|||.|.:.|:|  ...|...:.||             
 Worm   426 LKKVDLSHNRIAKVYQYVLNKIKQLHTVDLSNNQLQSIG--PYIFSDSSELHSLDVSNNEISLLF 488

  Fly   527 ------------VNMTHNKIRRI--------------------------ALPEDVHLGEGYNNNL 553
                        ::|..|||:.:                          ||||::.:....||::
 Worm   489 KDAFARCPKLRKISMKMNKIKSLDEGLTEASGLRRLDVSHNEILVLKWSALPENLEILNADNNDI 553

  Fly   554 ----------------------------------------------------------------- 553
                                                                             
 Worm   554 NLLTAASMSPSTANLKSVSLSNNGITIMNADQIPNSLESLDVSNNRLAKLGKTALAAKSQLRRLN 618

  Fly   554 -------------------VH---VDLNDNPLVCDCTILWFIQLVRGVHKPQYSRQFKLRTDRLV 596
                               ||   |::::|||:|||.:.|.|    |..||:.     |..|...
 Worm   619 LKGNLLTVVATESMKVVEAVHPLKVEISENPLICDCQMGWMI----GGAKPKV-----LIQDSET 674

  Fly   597 CSQPNVLEG--TPVRQIEPQTLICPLDFSDDPR-----------ERKCPRGCNCHVRTYDKALVI 648
            .|..:.::|  ..::.:..:.|:||.....:|.           :..||..|.|.........::
 Worm   675 ASCSHAVDGHQIQIQSLSKKDLLCPYKSVCEPECICCQYGNCDCKSVCPANCRCFRDDQFNINIV 739

  Fly   649 NCHSGNLTHVPR---------------------LPNLHKN-----MQLMELHLENNTLLR----- 682
            .|| ||.:.||:                     ||.|..:     ::|..||: |.|.||     
 Worm   740 RCH-GNSSMVPKREFVVSELPVSATEIILSGVTLPQLRTHSFIGRLRLQRLHI-NGTGLRSIQPK 802

  Fly   683 ----LPSANT-----------PGYE-----SVTSLHLAGNNLTSID---VDQLPTNLTHLDISWN 724
                ||:..|           .|.|     .|:.|.|.||..:::.   .::|| ||.:|.:..|
 Worm   803 AFHTLPALKTLDLSDNSLISLSGEEFLKCGEVSQLFLNGNRFSTLSRGIFEKLP-NLKYLTLHNN 866

  Fly   725 HL----QMLNATVLGFLNRTMKWRSVKLSGNPWMCDCT--------------AKPLLLFTQDNFE 771
            .|    |:|::|.|.         .:.||.||..|||:              |.|   |.:.|..
 Worm   867 SLEDIPQVLHSTALS---------KISLSSNPLRCDCSGGSQQHLHHRRDPKAHP---FWEHNAA 919

  Fly   772 R--------IGDRNEMMC--------------VNAEMPTRM--------VELSTND----IC-PA 801
            .        :.|..::.|              |.:..|..|        :|....|    || |.
 Worm   920 EWFSLHRHLVVDFPKVECWENVTKAFLTNDTTVLSAYPPNMGNDVFVMPIEEFLRDYNSTICVPF 984

  Fly   802 EKGVF--------------IALAVVIALTGLLAGFTAALYYKFQTEIKIWLY-AHNL-------- 843
            ..|.|              |::||::.:..:||   .:...|....|....| |.:|        
 Worm   985 SSGFFGQDPQNSILFVIITISIAVLLCVLVILA---ISFIRKSHDAINQRRYKASSLNCSTSAGS 1046

  Fly   844 ------LLWFVTEEDLDKDKKFDAFISYSHKDQSFIEDYLVPQLEHGPQKFQLCVHERD---WLV 899
                  ||            .:.||:|||.||:..:.|.|...||  .:.:|||:..||   :..
 Worm  1047 SPLPVPLL------------SYHAFVSYSKKDEKMVIDQLCRPLE--DEDYQLCLLHRDGPTYCS 1097

  Fly   900 GGH-IPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGDVEK 963
            ..| |.:.::..:..|:..|:||:::|:::||..|:.:.:|: ...:.|::.::.:..|..|...
 Worm  1098 NLHAISDELIAQMDSSQCLILVLTKHFLENEWKTLQIKTSHQ-LFAKNRAKRVIAVLGDGVDANL 1161

  Fly   964 LDEELKAYLKMNTYLKWGDPWFWDKLRFALPHRRPVGNIGNGALIKTALKGSTDDKLEL------ 1022
            ||:||...|:.:|.::.....||..|..:||.|.|:.:            .|.||..:|      
 Worm  1162 LDDELGQILRKHTRIEMRSHLFWTLLHSSLPSRLPLPS------------NSGDDSSQLYSDIYG 1214

  Fly  1023 IKPSPV 1028
            |.||.|
 Worm  1215 IVPSDV 1220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 16/64 (25%)
leucine-rich repeat 176..198 CDD:275380 7/27 (26%)
leucine-rich repeat 199..222 CDD:275380 4/23 (17%)
LRR_RI 216..542 CDD:238064 98/426 (23%)
LRR_8 221..281 CDD:290566 15/60 (25%)
leucine-rich repeat 223..270 CDD:275380 13/47 (28%)
leucine-rich repeat 271..294 CDD:275380 2/23 (9%)
leucine-rich repeat 295..320 CDD:275380 5/30 (17%)
leucine-rich repeat 321..343 CDD:275380 9/26 (35%)
LRR_8 342..402 CDD:290566 22/89 (25%)
leucine-rich repeat 344..367 CDD:275380 8/29 (28%)
leucine-rich repeat 368..391 CDD:275380 10/30 (33%)
LRR_8 390..450 CDD:290566 17/60 (28%)
leucine-rich repeat 392..415 CDD:275380 6/23 (26%)
leucine-rich repeat 416..439 CDD:275380 7/23 (30%)
leucine-rich repeat 440..474 CDD:275380 9/45 (20%)
leucine-rich repeat 475..498 CDD:275380 7/23 (30%)
LRR_8 477..534 CDD:290566 20/82 (24%)
leucine-rich repeat 499..520 CDD:275380 8/21 (38%)
leucine-rich repeat 523..552 CDD:275380 12/80 (15%)
LRRCT 561..619 CDD:214507 17/60 (28%)
LRRNT 631..667 CDD:214470 13/57 (23%)
leucine-rich repeat 664..693 CDD:275380 13/59 (22%)
LRR_8 669..726 CDD:290566 23/85 (27%)
leucine-rich repeat 694..715 CDD:275380 7/24 (29%)
leucine-rich repeat 716..737 CDD:275380 8/25 (32%)
LRRCT 751..800 CDD:214507 18/98 (18%)
TIR 858..996 CDD:214587 41/142 (29%)
tol-1NP_001020983.1 leucine-rich repeat 71..95 CDD:275380 4/24 (17%)
leucine-rich repeat 96..119 CDD:275380 6/23 (26%)
leucine-rich repeat 120..171 CDD:275380 11/51 (22%)
leucine-rich repeat 172..195 CDD:275380 8/23 (35%)
leucine-rich repeat 196..283 CDD:275380 28/128 (22%)
leucine-rich repeat 219..240 CDD:275378 5/30 (17%)
leucine-rich repeat 241..258 CDD:275378 7/17 (41%)
leucine-rich repeat 287..306 CDD:275380 1/19 (5%)
LRR_RI 305..531 CDD:238064 55/234 (24%)
LRR_8 305..366 CDD:290566 22/67 (33%)
leucine-rich repeat 307..331 CDD:275380 8/24 (33%)
leucine-rich repeat 332..355 CDD:275380 8/29 (28%)
leucine-rich repeat 356..379 CDD:275380 7/23 (30%)
leucine-rich repeat 380..395 CDD:275380 4/15 (27%)
LRR_8 402..460 CDD:290566 16/58 (28%)
leucine-rich repeat 403..425 CDD:275380 3/22 (14%)
leucine-rich repeat 426..449 CDD:275380 7/23 (30%)
LRR_8 448..508 CDD:290566 14/62 (23%)
leucine-rich repeat 450..473 CDD:275380 8/25 (32%)
leucine-rich repeat 474..497 CDD:275380 2/23 (9%)
leucine-rich repeat 498..520 CDD:275380 4/22 (18%)
leucine-rich repeat 543..567 CDD:275380 2/24 (8%)
LRR_8 567..624 CDD:290566 0/57 (0%)
leucine-rich repeat 568..589 CDD:275380 0/21 (0%)
leucine-rich repeat 590..613 CDD:275380 0/23 (0%)
leucine-rich repeat 614..633 CDD:275380 0/19 (0%)
leucine-rich repeat 763..785 CDD:275378 3/22 (14%)
LRR_8 785..844 CDD:290566 17/60 (28%)
leucine-rich repeat 786..809 CDD:275378 9/24 (38%)
leucine-rich repeat 810..833 CDD:275378 3/23 (13%)
leucine-rich repeat 834..857 CDD:275378 7/24 (29%)
LRR_8 837..890 CDD:290566 19/63 (30%)
leucine-rich repeat 858..879 CDD:275378 7/21 (33%)
leucine-rich repeat 880..892 CDD:275378 5/21 (24%)
TIR_2 1059..1171 CDD:304906 34/115 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 1 1.000 FOG0004562
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.870

Return to query results.
Submit another query.