DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and Tlr8

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_573475.2 Gene:Tlr8 MGIID:2176887 Length:1032 Species:Mus musculus

Alignment Length:1029 Identity:232/1030 (23%)
Similarity:392/1030 (38%) Gaps:294/1030 (29%)


  Fly   133 ESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLE 197
            |:.| |||||...|..|..|........:|..|||.|...::.||.::  .||.::..:....|.
Mouse   105 ENKN-GMNITEGALLSLRNLTVLLLEDNQLYTIPAGLPESLKELSLIQ--NNIFQVTKNNTFGLR 166

  Fly   198 NLESIEFG------SNKLRQMPRGIFGKMPKLKQLNLWSNQLH---------------------N 235
            |||.:..|      .|:..::..|.|..:..||.|:|..|.|.                     |
Mouse   167 NLERLYLGWNCYFKCNQTFKVEDGAFKNLIHLKVLSLSFNNLFYVPPKLPSSLRKLFLSNAKIMN 231

  Fly   236 LTKHDFEGATSVLGIDIHDN--------------------GIEQLPHDVFAHLTNVTDINLSANL 280
            :|:.||:|..::..:|:..|                    .|..|   .|..||.:..:|||:..
Mouse   232 ITQEDFKGLENLTLLDLSGNCPRCYNAPFPCTPCKENSSIHIHPL---AFQSLTQLLYLNLSSTS 293

  Fly   281 FRSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRLRAELQSLPGDLFEHSTQIT 345
            .|::|...|::..:|.|:.|..|.:.............|.||||.|....|      ::...|..
Mouse   294 LRTIPSTWFENLSNLKELHLEFNYLVQEIASGAFLTKLPSLQILDLSFNFQ------YKEYLQFI 352

  Fly   346 NISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLEDNLLTGISGDIF 410
            |||...:.|::|...   |....:..:|......|| .||    .||..:.|..|.:..|....|
Mouse   353 NISSNFSKLRSLKKL---HLRGYVFRELKKKHFEHL-QSL----PNLATINLGINFIEKIDFKAF 409

  Fly   411 SNLGNLVTLVMSRNRLRTI-DSRAFVS-TNGLR------------HLHLDHNDIDLQQP------ 455
            .|...|..:.:|.||:.:: |...:.| .|.||            |::..|:...|.:|      
Mouse   410 QNFSKLDVIYLSGNRIASVLDGTDYSSWRNRLRKPLSTDDDEFDPHVNFYHSTKPLIKPQCTAYG 474

  Fly   456 -LLDIML--------------------------QTQI--NSPFGYMHGLLTLNLRNNSIIFVYND 491
             .||:.|                          .||:  .:.|..|..:..|:|.||.:.|..|:
Mouse   475 KALDLSLNNIFIIGKSQFEGFQDIACLNLSFNANTQVFNGTEFSSMPHIKYLDLTNNRLDFDDNN 539

  Fly   492 WKNTMLQLRELDLSYN----NISSLGYEDLAFLSQNRLH---VNMTHN---------KIRRIALP 540
            ..:.:..|..||||:|    :|:.:.:. |.|: ||.::   :|::||         :::.|:|.
Mouse   540 AFSDLHDLEVLDLSHNAHYFSIAGVTHR-LGFI-QNLINLRVLNLSHNGIYTLTEESELKSISLK 602

  Fly   541 EDVHLGEGYN-----------------NNLVHVDLNDNPLVCDCTILWFIQLVRG--VHKPQYSR 586
            |.|..|...:                 .||:.:||:.|.|.         |:..|  ::.||..:
Mouse   603 ELVFSGNRLDRLWNANDGKYWSIFKSLQNLIRLDLSYNNLQ---------QIPNGAFLNLPQSLQ 658

  Fly   587 QFKLRTDRLVCSQPNVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCH 651
            :.             ::.|..:|..                                        
Mouse   659 EL-------------LISGNKLRFF---------------------------------------- 670

  Fly   652 SGNLTHVPRLPNLHKNMQLMELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVDQLPT-- 714
              |.|.:...|:||.      |.|..|.|..||:..:....|:.:|.|:.|:.:     .||:  
Mouse   671 --NWTLLQYFPHLHL------LDLSRNELYFLPNCLSKFAHSLETLLLSHNHFS-----HLPSGF 722

  Fly   715 -----NLTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLSGNPWMCDCTAKPLLLFTQDNFERIG 774
                 ||.|||:|:|.::|:|.:.|....:| ....::|.||.:.|.|.......:..:|     
Mouse   723 LSEARNLVHLDLSFNTIKMINKSSLQTKMKT-NLSILELHGNYFDCTCDISDFRSWLDEN----- 781

  Fly   775 DRNEMMCVNAEMPTRMVELSTNDICPAEKGVFIALAVVIALTGLLAGFTAAL--YYKFQTEIKIW 837
                   :|..:|..:..:.:|......|.:     :.:.||..::..|||:  :..|.|...:.
Mouse   782 -------LNITIPKLVNVICSNPGDQKSKSI-----MSLDLTTCVSDTTAAVLFFLTFLTTSMVM 834

  Fly   838 LYA--HNLL---LWFVTEEDLDKDKK----------FDAFISYSHKDQSFIEDYLVPQLEHGPQK 887
            |.|  |:|.   :||:......|.|.          :||:|||..||.| :.|:::.:|.:..::
Mouse   835 LAALVHHLFYWDVWFIYHMCSAKLKGYRTSSTSQTFYDAYISYDTKDAS-VTDWVINELRYHLEE 898

  Fly   888 FQ-----LCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGR 947
            .:     ||:.||||..|..|.:|:|:|:..|::||.||::.:.||...:..|..|.:..::|..
Mouse   899 SEDKSVLLCLEERDWDPGLPIIDNLMQSINQSKKTIFVLTKKYAKSWNFKTAFYLALQRLMDENM 963

  Fly   948 SRIIVIIYSDIGDVEKLDEELKAYLKM------NTYLKW-----GDPWFWDKLR 990
            ..||.|:...:       .:...||::      ::.|:|     .:..||..|:
Mouse   964 DVIIFILLEPV-------LQYSQYLRLRQRICKSSILQWPNNPKAENLFWQSLK 1010

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 17/65 (26%)
leucine-rich repeat 176..198 CDD:275380 5/22 (23%)
leucine-rich repeat 199..222 CDD:275380 6/29 (21%)
LRR_RI 216..542 CDD:238064 98/432 (23%)
LRR_8 221..281 CDD:290566 21/101 (21%)
leucine-rich repeat 223..270 CDD:275380 18/88 (20%)
leucine-rich repeat 271..294 CDD:275380 6/23 (26%)
leucine-rich repeat 295..320 CDD:275380 5/25 (20%)
leucine-rich repeat 321..343 CDD:275380 6/22 (27%)
LRR_8 342..402 CDD:290566 16/60 (27%)
leucine-rich repeat 344..367 CDD:275380 6/23 (26%)
leucine-rich repeat 368..391 CDD:275380 5/23 (22%)
LRR_8 390..450 CDD:290566 18/74 (24%)
leucine-rich repeat 392..415 CDD:275380 6/23 (26%)
leucine-rich repeat 416..439 CDD:275380 7/25 (28%)
leucine-rich repeat 440..474 CDD:275380 13/81 (16%)
leucine-rich repeat 475..498 CDD:275380 6/23 (26%)
LRR_8 477..534 CDD:290566 20/73 (27%)
leucine-rich repeat 499..520 CDD:275380 9/25 (36%)
leucine-rich repeat 523..552 CDD:275380 9/58 (16%)
LRRCT 561..619 CDD:214507 8/60 (13%)
LRRNT 631..667 CDD:214470 5/36 (14%)
leucine-rich repeat 664..693 CDD:275380 8/29 (28%)
LRR_8 669..726 CDD:290566 19/64 (30%)
leucine-rich repeat 694..715 CDD:275380 5/28 (18%)
leucine-rich repeat 716..737 CDD:275380 9/21 (43%)
LRRCT 751..800 CDD:214507 7/49 (14%)
TIR 858..996 CDD:214587 41/160 (26%)
Tlr8NP_573475.2 LRR_RI 32..252 CDD:238064 40/150 (27%)
LRR 1 41..61
LRR 2 62..85
LRR_8 65..133 CDD:290566 10/29 (34%)
leucine-rich repeat 65..88 CDD:275380
LRR 3 87..109 2/5 (40%)
leucine-rich repeat 89..122 CDD:275380 9/18 (50%)
LRR 4 120..143 7/23 (30%)
leucine-rich repeat 123..143 CDD:275380 6/20 (30%)
leucine-rich repeat 144..167 CDD:275380 5/25 (20%)
LRR 5 145..165 4/22 (18%)
LRR_8 166..251 CDD:290566 19/85 (22%)
LRR 6 166..194 7/28 (25%)
leucine-rich repeat 168..197 CDD:275380 6/29 (21%)
LRR 7 195..218 6/23 (26%)
leucine-rich repeat 198..218 CDD:275380 6/20 (30%)
leucine-rich repeat 219..242 CDD:275380 5/23 (22%)
LRR 8 220..239 4/19 (21%)
LRR 9 240..267 2/27 (7%)
leucine-rich repeat 243..283 CDD:275380 7/43 (16%)
LRR_RI <277..>428 CDD:238064 43/165 (26%)
LRR 10 281..304 8/23 (35%)
LRR_8 282..342 CDD:290566 17/60 (28%)
leucine-rich repeat 284..307 CDD:275380 6/23 (26%)
LRR 11 306..329 4/23 (17%)
leucine-rich repeat 308..327 CDD:275380 4/19 (21%)
LRR 12 331..360 11/35 (31%)
leucine-rich repeat 334..363 CDD:275380 11/35 (31%)
LRR 13 361..384 4/26 (15%)
LRR_8 362..425 CDD:290566 18/71 (25%)
leucine-rich repeat 364..390 CDD:275380 7/34 (21%)
LRR 14 388..411 7/27 (26%)
leucine-rich repeat 391..414 CDD:275380 6/23 (26%)
LRR 15 413..436 5/23 (22%)
leucine-rich repeat 465..497 CDD:275380 5/32 (16%)
LRR 16 471..494 3/23 (13%)
LRR_8 475..533 CDD:290566 11/58 (19%)
leucine-rich repeat 501..522 CDD:275380 4/21 (19%)
LRR 17 520..543 7/23 (30%)
LRR_8 521..587 CDD:290566 20/68 (29%)
leucine-rich repeat 523..546 CDD:275380 6/23 (26%)
LRR 18 545..572 9/29 (31%)
LRR_RI 546..765 CDD:238064 62/297 (21%)
leucine-rich repeat 547..576 CDD:275380 11/31 (35%)
LRR 19 574..598 3/24 (13%)
leucine-rich repeat 577..600 CDD:275380 4/23 (17%)
LRR_8 600..667 CDD:290566 15/89 (17%)
LRR 20 600..621 4/21 (19%)
leucine-rich repeat 601..631 CDD:275380 4/30 (13%)
LRR 21 629..652 8/32 (25%)
leucine-rich repeat 632..656 CDD:275380 9/33 (27%)
LRR 22 654..677 6/78 (8%)
leucine-rich repeat 657..680 CDD:275380 5/78 (6%)
LRR 23 678..701 9/29 (31%)
LRR_8 679..737 CDD:290566 21/69 (30%)
leucine-rich repeat 681..704 CDD:275380 8/29 (28%)
LRR 24 702..725 6/28 (21%)
leucine-rich repeat 705..728 CDD:275380 5/28 (18%)
LRR 25 727..749 10/22 (45%)
leucine-rich repeat 729..748 CDD:275380 9/19 (47%)
LRR 26 752..776 6/25 (24%)
TIR 871..1007 CDD:214587 40/144 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.