DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and Tlr7

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001277687.1 Gene:Tlr7 MGIID:2176882 Length:1053 Species:Mus musculus

Alignment Length:1101 Identity:243/1102 (22%)
Similarity:424/1102 (38%) Gaps:306/1102 (28%)


  Fly    39 IDGLCQCAPIMSEYEIICPANAENPTFRLTIQPKDYVQIMCNLTDTTDYQQLPKKLRIGEVDRVQ 103
            ||..|.|.|      ::..:.|...|.||.|:|..:    ..|:|          |:...:|..|
Mouse    97 IDLRCNCVP------VLLGSKANVCTKRLQIRPGSF----SGLSD----------LKALYLDGNQ 141

  Fly   104 MRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPAN 168
            :..  :|...|  |.|..|.:        |::|: .:||:::|..|..::............|.|
Mouse   142 LLE--IPQDLP--SSLHLLSL--------EANNI-FSITKENLTELVNIETLYLGQNCYYRNPCN 193

  Fly   169 L--------LTDMRNLSHLELR-ANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLK 224
            :        ...||||..|.|: .|:..:|:.|   ..||..:...:|.::::....|..:.:|:
Mouse   194 VSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTL---PPNLLELYLYNNIIKKIQENDFNNLNELQ 255

  Fly   225 QLNLWSN--QLHN-------------LTKHD--FEGATSVLGIDIHDNGIEQLPHDVFAHLTNVT 272
            .|:|..|  :.:|             |..||  |...|.:..:.:|.|.::.:|...|.::.|:.
Mouse   256 VLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQ 320

  Fly   273 DINLSAN-LFRSLPQGLFDHNKHLNEVRLMNNRVPL--------------ATLPSRLFANQPELQ 322
            :::||.| |.|.:.:..|.|        .:.|.|.|              .|||..| ::...|:
Mouse   321 ELDLSQNYLAREIEEAKFLH--------FLPNLVELDFSFNYELQVYHASITLPHSL-SSLENLK 376

  Fly   323 ILRLRA----ELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLPD 383
            |||::.    ||::....:.....::..:.||.|.:|.....:.:|..||..:|||.|:::...:
Mouse   377 ILRVKGYVFKELKNSSLSVLHKLPRLEVLDLGTNFIKIADLNIFKHFENLKLIDLSVNKISPSEE 441

  Fly   384 SLFAHTTNLTDLRLEDNLLTGI---SGDIFSNLGNLVTLVMSRN-RLRTIDSRAFVSTNGLRHLH 444
            |        .::....|..|.:   ...:...|........:|: |.:..:..:|:..|...|::
Mouse   442 S--------REVGFCPNAQTSVDRHGPQVLEALHYFRYDEYARSCRFKNKEPPSFLPLNADCHIY 498

  Fly   445 -----LDHNDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVYND---WKNTMLQLRE 501
                 |..|:|...:|           |.|.::..|..|||..|:|....|.   |  .:.:||.
Mouse   499 GQTLDLSRNNIFFIKP-----------SDFQHLSFLKCLNLSGNTIGQTLNGSELW--PLRELRY 550

  Fly   502 LDLSYNNIS---SLGYEDLAFLSQNRLHVN--------MTH--NKIRRIALPEDVHLGEGYNNNL 553
            ||.|.|.:.   |..:|:|..|....|..|        :||  |..:::.|             |
Mouse   551 LDFSNNRLDLLYSTAFEELQSLEVLDLSSNSHYFQAEGITHMLNFTKKLRL-------------L 602

  Fly   554 VHVDLNDNPLVCDCT---------ILWFIQLVRGVH--------KPQYSRQFK---------LRT 592
            ..:.:|||.:....:         ||.|    ||.|        ..:|...||         :..
Mouse   603 DKLMMNDNDISTSASRTMESDSLRILEF----RGNHLDVLWRAGDNRYLDFFKNLFNLEVLDISR 663

  Fly   593 DRLVCSQPNVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTH 657
            :.|....|.|.||.|                                                  
Mouse   664 NSLNSLPPEVFEGMP-------------------------------------------------- 678

  Fly   658 VPRLPNLH--KN---------MQLME----LHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSI 707
             |.|.||.  ||         :||::    |.|.:|.|.::|.......:|:|:|.|..|.:..:
Mouse   679 -PNLKNLSLAKNGLKSFFWDRLQLLKHLEILDLSHNQLTKVPERLANCSKSLTTLILKHNQIRQL 742

  Fly   708 D----VDQLPTNLTHLDISWNHLQMLNAT-----VLGFLNRTMKWRSVKLSGNPWMCDCTAKPLL 763
            .    .|.|  .|.:||||.|.:|::..|     ||..|...:      |..|.::|:|.|...:
Mouse   743 TKYFLEDAL--QLRYLDISSNKIQVIQKTSFPENVLNNLEMLV------LHHNRFLCNCDAVWFV 799

  Fly   764 LFTQDNFERI------------GDRNEMMCVNAEMPTRMVELSTNDICPAEKGVFIALAVVIALT 816
            .:.......|            |.......::.::.|..::|:...:........:.|.||:..:
Mouse   800 WWVNHTDVTIPYLATDVTCVGPGAHKGQSVISLDLYTCELDLTNLILFSVSISSVLFLMVVMTTS 864

  Fly   817 GLLAGFTAALYYKFQTEIKIWLYAHNLLLWFVTEEDLDKDKKFDAFISYSHKDQSFIE---DYLV 878
            .|.......:||.::.:||.:.:..::            :..:||||.|..|:.:..|   ..||
Mouse   865 HLFFWDMWYIYYFWKAKIKGYQHLQSM------------ESCYDAFIVYDTKNSAVTEWVLQELV 917

  Fly   879 PQLEHGPQK-FQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSA 942
            .:||...:| |.||:.|||||.|..:.||:.:|:..|::|:.|::|.:.|:|..::.|..:|:..
Mouse   918 AKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTQKYAKTESFKMAFYLSHQRL 982

  Fly   943 LNEGRSRIIVIIYSDIGDVEK-LDE----ELKAYLKMNTYLKW-----GDPWFWDKLRFAL 993
            |:| :..:|::|:     :|| |.:    :|:..|..::.|:|     ..|:||..|:.||
Mouse   983 LDE-KVDVIILIF-----LEKPLQKSKFLQLRKRLCRSSVLEWPANPQAHPYFWQCLKNAL 1037

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 16/62 (26%)
leucine-rich repeat 176..198 CDD:275380 6/23 (26%)
leucine-rich repeat 199..222 CDD:275380 3/23 (13%)
LRR_RI 216..542 CDD:238064 86/387 (22%)
LRR_8 221..281 CDD:290566 19/78 (24%)
leucine-rich repeat 223..270 CDD:275380 14/64 (22%)
leucine-rich repeat 271..294 CDD:275380 7/24 (29%)
leucine-rich repeat 295..320 CDD:275380 7/39 (18%)
leucine-rich repeat 321..343 CDD:275380 6/26 (23%)
LRR_8 342..402 CDD:290566 13/60 (22%)
leucine-rich repeat 344..367 CDD:275380 5/23 (22%)
leucine-rich repeat 368..391 CDD:275380 6/23 (26%)
LRR_8 390..450 CDD:290566 10/69 (14%)
leucine-rich repeat 392..415 CDD:275380 3/26 (12%)
leucine-rich repeat 416..439 CDD:275380 4/24 (17%)
leucine-rich repeat 440..474 CDD:275380 7/39 (18%)
leucine-rich repeat 475..498 CDD:275380 8/26 (31%)
LRR_8 477..534 CDD:290566 22/73 (30%)
leucine-rich repeat 499..520 CDD:275380 9/24 (38%)
leucine-rich repeat 523..552 CDD:275380 6/39 (15%)
LRRCT 561..619 CDD:214507 16/84 (19%)
LRRNT 631..667 CDD:214470 5/38 (13%)
leucine-rich repeat 664..693 CDD:275380 10/44 (23%)
LRR_8 669..726 CDD:290566 20/65 (31%)
leucine-rich repeat 694..715 CDD:275380 6/25 (24%)
leucine-rich repeat 716..737 CDD:275380 10/26 (38%)
LRRCT 751..800 CDD:214507 8/61 (13%)
TIR 858..996 CDD:214587 49/151 (32%)
Tlr7NP_001277687.1 leucine-rich repeat 51..72 CDD:275380
leucine-rich repeat 73..93 CDD:275380
LRR_RI 88..410 CDD:238064 79/358 (22%)
leucine-rich repeat 94..131 CDD:275380 12/44 (27%)
leucine-rich repeat 132..155 CDD:275380 7/27 (26%)
leucine-rich repeat 177..208 CDD:275380 4/31 (13%)
LRR_8 207..262 CDD:290566 15/58 (26%)
leucine-rich repeat 209..229 CDD:275380 6/23 (26%)
leucine-rich repeat 230..253 CDD:275380 3/23 (13%)
leucine-rich repeat 254..294 CDD:275380 10/40 (25%)
LRR_8 293..353 CDD:290566 16/68 (24%)
leucine-rich repeat 295..318 CDD:275380 4/23 (17%)
leucine-rich repeat 319..344 CDD:275380 7/33 (21%)
leucine-rich repeat 345..401 CDD:275380 12/57 (21%)
leucine-rich repeat 402..425 CDD:275380 5/23 (22%)
LRR_RI 456..723 CDD:238064 68/348 (20%)
LRR_8 500..558 CDD:290566 20/71 (28%)
leucine-rich repeat 500..522 CDD:275380 6/33 (18%)
leucine-rich repeat 523..547 CDD:275380 8/26 (31%)
leucine-rich repeat 548..571 CDD:275380 9/23 (39%)
leucine-rich repeat 572..601 CDD:275380 6/29 (21%)
leucine-rich repeat 602..624 CDD:275380 4/22 (18%)
LRR_8 624..691 CDD:290566 21/122 (17%)
leucine-rich repeat 625..655 CDD:275380 9/34 (26%)
leucine-rich repeat 656..680 CDD:275380 7/75 (9%)
LRR_8 679..739 CDD:290566 18/60 (30%)
leucine-rich repeat 681..704 CDD:275380 7/23 (30%)
leucine-rich repeat 705..728 CDD:275380 5/23 (22%)
LRR_8 727..789 CDD:290566 20/70 (29%)
leucine-rich repeat 753..778 CDD:275380 10/25 (40%)
TIR 894..1039 CDD:214587 49/151 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.