DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and Tlr3

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001344245.1 Gene:Tlr3 MGIID:2156367 Length:905 Species:Mus musculus

Alignment Length:995 Identity:236/996 (24%)
Similarity:397/996 (40%) Gaps:228/996 (23%)


  Fly   123 GIVSPTTLIFESDN---LGMNITR-QHLDRLHGLKRFRFTTRRLTHIPANLLTDMR--NLSHLEL 181
            |::|...|:..|.|   :..|:.. .||              :|||||.:|.:::.  ||:|.:|
Mouse    14 GLLSLWILLVSSTNQCTVRYNVADCSHL--------------KLTHIPDDLPSNITVLNLTHNQL 64

  Fly   182 RANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATS 246
            |    .:|...|.....|..::.|.|.:.::...:...:|.||.|||..|:|..::...|...|:
Mouse    65 R----RLPPTNFTRYSQLAILDAGFNSISKLEPELCQILPLLKVLNLQHNELSQISDQTFVFCTN 125

  Fly   247 VLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATLP 311
            :..:|:..|.|.::..:.|.:..|:..::||.|...|...|.....::|.|:.|..|::      
Mouse   126 LTELDLMSNSIHKIKSNPFKNQKNLIKLDLSHNGLSSTKLGTGVQLENLQELLLAKNKI------ 184

  Fly   312 SRLFANQPELQIL---RLR-AELQSLP------------GDLFE--------------------H 340
              |.....||:.|   .|| .:|.|.|            |.||.                    .
Mouse   185 --LALRSEELEFLGNSSLRKLDLSSNPLKEFSPGCFQTIGKLFALLLNNAQLNPHLTEKLCWELS 247

  Fly   341 STQITNISLGDN-LLKTLPATLLEHQ-VNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLEDNLLT 403
            :|.|.|:||.:| ||.|..:|....: .||..||||.|.|..:.:..|::..:|..|.||.|.:.
Mouse   248 NTSIQNLSLANNQLLATSESTFSGLKWTNLTQLDLSYNNLHDVGNGSFSYLPSLRYLSLEYNNIQ 312

  Fly   404 GISGDIFSNLGNLVTLVMSRNRLR---------TIDSRAFVSTNGLRHLHLDHNDIDLQQP---- 455
            .:|...|..|.||..|.:.|...:         .||..:|.....|.:|::|.|:|...:.    
Mouse   313 RLSPRSFYGLSNLRYLSLKRAFTKQSVSLASHPNIDDFSFQWLKYLEYLNMDDNNIPSTKSNTFT 377

  Fly   456 -LLDI----------MLQTQINSPF-GYMHG-LLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYN 507
             |:.:          .|||..|..| ...|. ||||||..|.|..:.|...:.:.|||.|||..|
Mouse   378 GLVSLKYLSLSKTFTSLQTLTNETFVSLAHSPLLTLNLTKNHISKIANGTFSWLGQLRILDLGLN 442

  Fly   508 NI-SSLGYEDLAFLSQNRLHVNMTHNK-------------------IRRIALPEDVHLGEGYNNN 552
            .| ..|..::...| :|...:.:::||                   :||:||.            
Mouse   443 EIEQKLSGQEWRGL-RNIFEIYLSYNKYLQLSTSSFALVPSLQRLMLRRVALK------------ 494

  Fly   553 LVHVDLNDNPL--VCDCTILWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQT 615
              :||::.:|.  :.:.|||                  .|..:.:.....::|||....:|    
Mouse   495 --NVDISPSPFRPLRNLTIL------------------DLSNNNIANINEDLLEGLENLEI---- 535

  Fly   616 LICPLDFSDDPR----ERKCPRGCNCHVRTYDKALVINCHSGNLTHVPRLPNLHKNM-QLMELHL 675
                |||..:..    :|..|.|....::......::|..|..|..:|  ..:.||: :|..::|
Mouse   536 ----LDFQHNNLARLWKRANPGGPVNFLKGLSHLHILNLESNGLDEIP--VGVFKNLFELKSINL 594

  Fly   676 ENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVDQLP---TNLTHLDISWNHLQMLNATVLGFL 737
            ..|.|.:|.........|:.||:|..|.:||::.|...   .||..||:.:|.......::..|:
Mouse   595 GLNNLNKLEPFIFDDQTSLRSLNLQKNLITSVEKDVFGPPFQNLNSLDMRFNPFDCTCESISWFV 659

  Fly   738 NRTMKW-----RSVKLSGNPWMCDCT----AKPLLLFTQDNFERIGDRNEMMCVNAEMPTRMVEL 793
            |    |     .::......::|:..    ..||.||...:           |.::.....:..:
Mouse   660 N----WINQTHTNISELSTHYLCNTPHHYYGFPLKLFDTSS-----------CKDSAPFELLFII 709

  Fly   794 STNDICPAEKGVFIALAVVIALTGLLAGFTAALYYKFQTEIKIWLYAHNLLLWFVTEEDLDKDKK 858
            ||:.:.     |||.:.::|.:.|....|             .|..:.:.:|.|...:...:..:
Mouse   710 STSMLL-----VFILVVLLIHIEGWRISF-------------YWNVSVHRILGFKEIDTQAEQFE 756

  Fly   859 FDAFISYSHKDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQ 923
            :.|:|.::|||:.::.::..| :|...|..:.|:.|||:..|....|.|:.|:..||:.|.|::.
Mouse   757 YTAYIIHAHKDRDWVWEHFSP-MEEQDQSLKFCLEERDFEAGVLGLEAIVNSIKRSRKIIFVITH 820

  Fly   924 NFIKSEWARLEFRAAH--RSALNEGRSRIIVIIYSDIGDVEKLDEEL---KAYLKMNTYLKWGDP 983
            :.:|....| .|:..|  :.|:.:....||:|...:|.|. ||:..|   :...|.:..|.|  |
Mouse   821 HLLKDPLCR-RFKVHHAVQQAIEQNLDSIILIFLQNIPDY-KLNHALCLRRGMFKSHCILNW--P 881

  Fly   984 -------WFWDKLRFALPHR 996
                   .|..||:.||..|
Mouse   882 VQKERINAFHHKLQVALGSR 901

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 17/61 (28%)
leucine-rich repeat 176..198 CDD:275380 6/22 (27%)
leucine-rich repeat 199..222 CDD:275380 4/23 (17%)
LRR_RI 216..542 CDD:238064 108/410 (26%)
LRR_8 221..281 CDD:290566 18/60 (30%)
leucine-rich repeat 223..270 CDD:275380 13/47 (28%)
leucine-rich repeat 271..294 CDD:275380 5/23 (22%)
leucine-rich repeat 295..320 CDD:275380 5/25 (20%)
leucine-rich repeat 321..343 CDD:275380 11/58 (19%)
LRR_8 342..402 CDD:290566 24/62 (39%)
leucine-rich repeat 344..367 CDD:275380 9/25 (36%)
leucine-rich repeat 368..391 CDD:275380 8/23 (35%)
LRR_8 390..450 CDD:290566 19/69 (28%)
leucine-rich repeat 392..415 CDD:275380 8/23 (35%)
leucine-rich repeat 416..439 CDD:275380 6/32 (19%)
leucine-rich repeat 440..474 CDD:275380 12/50 (24%)
leucine-rich repeat 475..498 CDD:275380 9/23 (39%)
LRR_8 477..534 CDD:290566 20/77 (26%)
leucine-rich repeat 499..520 CDD:275380 8/22 (36%)
leucine-rich repeat 523..552 CDD:275380 7/48 (15%)
LRRCT 561..619 CDD:214507 9/60 (15%)
LRRNT 631..667 CDD:214470 7/36 (19%)
leucine-rich repeat 664..693 CDD:275380 7/30 (23%)
LRR_8 669..726 CDD:290566 18/60 (30%)
leucine-rich repeat 694..715 CDD:275380 7/24 (29%)
leucine-rich repeat 716..737 CDD:275380 5/21 (24%)
LRRCT 751..800 CDD:214507 8/53 (15%)
TIR 858..996 CDD:214587 42/150 (28%)
Tlr3NP_001344245.1 leucine-rich repeat 37..53 CDD:275380 8/30 (27%)
LRR 1 53..74 7/25 (28%)
leucine-rich repeat 54..77 CDD:275380 7/27 (26%)
PLN00113 70..>543 CDD:331614 126/522 (24%)
LRR 2 77..98 3/21 (14%)
leucine-rich repeat 78..101 CDD:275380 4/23 (17%)
LRR 3 101..122 8/21 (38%)
leucine-rich repeat 102..125 CDD:275380 9/23 (39%)
LRR 4 125..146 4/21 (19%)
leucine-rich repeat 126..149 CDD:275380 4/23 (17%)
LRR 5 149..170 6/21 (29%)
leucine-rich repeat 150..199 CDD:275380 13/57 (23%)
LRR 6 173..196 8/31 (26%)
LRR 7 199..220 5/21 (24%)
leucine-rich repeat 200..250 CDD:275380 9/50 (18%)
LRR 8 250..271 9/21 (43%)
leucine-rich repeat 251..276 CDD:275380 9/25 (36%)
LRR 9 276..297 9/21 (43%)
leucine-rich repeat 277..300 CDD:275380 8/23 (35%)
LRR 10 300..321 7/21 (33%)
leucine-rich repeat 301..324 CDD:275380 8/23 (35%)
LRR 11 324..345 4/21 (19%)
leucine-rich repeat 325..381 CDD:275380 12/56 (21%)
LRR 12 357..378 5/21 (24%)
LRR 13 381..401 4/20 (20%)
leucine-rich repeat 382..433 CDD:275380 15/51 (29%)
LRR 14 409..430 9/21 (43%)
LRR 15 433..454 9/21 (43%)
leucine-rich repeat 434..458 CDD:275380 9/25 (36%)
LRR 16 458..479 3/21 (14%)
leucine-rich repeat 459..482 CDD:275380 2/23 (9%)
LRR 17 482..502 6/34 (18%)
leucine-rich repeat 483..508 CDD:275380 7/39 (18%)
LRR 18 508..529 6/39 (15%)
leucine-rich repeat 509..532 CDD:275380 7/41 (17%)
LRR 19 532..553 6/29 (21%)
leucine-rich repeat 533..564 CDD:275380 7/39 (18%)
LRR 20 564..585 5/23 (22%)
leucine-rich repeat 565..586 CDD:275380 6/23 (26%)
LRR 21 588..609 5/21 (24%)
leucine-rich repeat 589..610 CDD:275378 5/21 (24%)
LRR 22 612..633 8/21 (38%)
leucine-rich repeat 613..637 CDD:275380 7/24 (29%)
LRRCT 646..698 CDD:214507 10/67 (15%)
TIR 756..901 CDD:214587 42/150 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.970

Return to query results.
Submit another query.