DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and TLR6

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_006059.2 Gene:TLR6 HGNCID:16711 Length:796 Species:Homo sapiens

Alignment Length:913 Identity:214/914 (23%)
Similarity:352/914 (39%) Gaps:253/914 (28%)


  Fly   160 RRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLE--------NLESIEFGSNKLRQMPRGI 216
            |.|.|:|.:          |.|:..:.:|..:...:|:        .|..:....|:::.:...:
Human    41 RGLIHVPKD----------LPLKTKVLDMSQNYIAELQVSDMSFLSELTVLRLSHNRIQLLDLSV 95

  Fly   217 FGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLF 281
            |.....|:.|:|..|||..::.|                     |...|.||      :||.|.|
Human    96 FKFNQDLEYLDLSHNQLQKISCH---------------------PIVSFRHL------DLSFNDF 133

  Fly   282 RSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRLRA-ELQSLPGDLFEHSTQIT 345
            ::||                         ..:.|.|..:|..|.|.| :||.|  ||.    .|.
Human   134 KALP-------------------------ICKEFGNLSQLNFLGLSAMKLQKL--DLL----PIA 167

  Fly   346 NISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHL---PDSLFAHTTNLTDLRLEDNLLTGISG 407
            ::.|...||......:.|::..  ||.:.|.:..||   |.||||...|:               
Human   168 HLHLSYILLDLRNYYIKENETE--SLQILNAKTLHLVFHPTSLFAIQVNI--------------- 215

  Fly   408 DIFSNLGNLVTLVMSRNRLRTIDSRAFVS-----TNGLRHLHLDHNDIDLQQPLLDIMLQTQINS 467
                ::..|..|.::..:|...:.:.|:.     |.|...|:...|.|:.....|..:.|.....
Human   216 ----SVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPK 276

  Fly   468 PFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYN--NISSLGYEDL---AFL-SQNRLH 526
            |..|      ||:.|.:||          ..:||.|.:|:  .:.:|..|.:   .|| ||..|:
Human   277 PVEY------LNIYNLTII----------ESIREEDFTYSKTTLKALTIEHITNQVFLFSQTALY 325

  Fly   527 VNMTHNKIRRIALPEDVHLGEGYNNNLVHVDLNDNP---LVCD--CTILWFIQLVRGVHK----P 582
            ...:                   ..|::.:.::|.|   ::|.  .:...|:...:.|..    .
Human   326 TVFS-------------------EMNIMMLTISDTPFIHMLCPHAPSTFKFLNFTQNVFTDSIFE 371

  Fly   583 QYSRQFKLRTDRLVCSQPNVLE-----GTPVRQIEPQTLICPLDFS----DDPRERKCPRGCNCH 638
            :.|...||.|   :..|.|.|:     |...:.: |...|  ||.|    :..|.::     || 
Human   372 KCSTLVKLET---LILQKNGLKDLFKVGLMTKDM-PSLEI--LDVSWNSLESGRHKE-----NC- 424

  Fly   639 VRTY-DKALVINCHSGNLTH------VPRLPNLHKNMQLMELHLENNTLLRLPSANTPGYESVTS 696
              |: :..:|:|..|..||.      .||:       ::::||  :|.:..:|. .....|::..
Human   425 --TWVESIVVLNLSSNMLTDSVFRCLPPRI-------KVLDLH--SNKIKSVPK-QVVKLEALQE 477

  Fly   697 LHLAGNNLTSIDVDQLPTNLTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLSGNPWMCDCTAKP 761
            |::|.|:||.:......::|:.|.|..|.:...:|   .|.....|.||:|...||:.|.|..:.
Human   478 LNVAFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSA---DFFQSCQKMRSIKAGDNPFQCTCELRE 539

  Fly   762 LLLFTQDNFERI------GDRNEMMCVNAE----MPTR---MVELSTNDICPAEKGVFIALAVVI 813
            .:    .|.:::      |..:...|...|    .|.:   |.|||.|         ...|.|.|
Human   540 FV----KNIDQVSSEVLEGWPDSYKCDYPESYRGSPLKDFHMSELSCN---------ITLLIVTI 591

  Fly   814 ALTGLLAGFTAALYYKFQTEIKIWL----YAHNLLLWFVTE--------EDLDKDKKFDAFISYS 866
            ..|.|:...|.       |.:.|:|    |...:..|..|.        |:|.::.:|.||||||
Human   592 GATMLVLAVTV-------TSLCIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYS 649

  Fly   867 HKDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWA 931
            ..|.::::..|||.||  .:..|:|:|||:::.|..|.|||:..:..|.::|.|||.||::|||.
Human   650 EHDSAWVKSELVPYLE--KEDIQICLHERNFVPGKSIVENIINCIEKSYKSIFVLSPNFVQSEWC 712

  Fly   932 RLEFRAAHRSALNEGRSRIIVIIYSDI--GDVEKLDEELKAYLKMNTYLKWGDP-----WFWDKL 989
            ..|...||.:..:||.:.:|:|:...|  ..:.....:|||.:...|||:|...     .||..:
Human   713 HYELYFAHHNLFHEGSNNLILILLEPIPQNSIPNKYHKLKALMTQRTYLQWPKEKSKRGLFWANI 777

  Fly   990 RFA 992
            |.|
Human   778 RAA 780

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 12/67 (18%)
leucine-rich repeat 176..198 CDD:275380 4/30 (13%)
leucine-rich repeat 199..222 CDD:275380 3/23 (13%)
LRR_RI 216..542 CDD:238064 74/341 (22%)
LRR_8 221..281 CDD:290566 14/60 (23%)
leucine-rich repeat 223..270 CDD:275380 11/47 (23%)
leucine-rich repeat 271..294 CDD:275380 6/23 (26%)
leucine-rich repeat 295..320 CDD:275380 2/25 (8%)
leucine-rich repeat 321..343 CDD:275380 9/23 (39%)
LRR_8 342..402 CDD:290566 16/63 (25%)
leucine-rich repeat 344..367 CDD:275380 5/23 (22%)
leucine-rich repeat 368..391 CDD:275380 10/26 (38%)
LRR_8 390..450 CDD:290566 9/65 (14%)
leucine-rich repeat 392..415 CDD:275380 0/23 (0%)
leucine-rich repeat 416..439 CDD:275380 5/28 (18%)
leucine-rich repeat 440..474 CDD:275380 7/34 (21%)
leucine-rich repeat 475..498 CDD:275380 5/23 (22%)
LRR_8 477..534 CDD:290566 16/63 (25%)
leucine-rich repeat 499..520 CDD:275380 7/26 (27%)
leucine-rich repeat 523..552 CDD:275380 1/29 (3%)
LRRCT 561..619 CDD:214507 14/72 (19%)
LRRNT 631..667 CDD:214470 10/43 (23%)
leucine-rich repeat 664..693 CDD:275380 5/29 (17%)
LRR_8 669..726 CDD:290566 14/57 (25%)
leucine-rich repeat 694..715 CDD:275380 5/21 (24%)
leucine-rich repeat 716..737 CDD:275380 6/21 (29%)
LRRCT 751..800 CDD:214507 14/62 (23%)
TIR 858..996 CDD:214587 52/143 (36%)
TLR6NP_006059.2 leucine-rich repeat 36..53 CDD:275380 6/22 (27%)
NEL <43..>208 CDD:330839 50/235 (21%)
leucine-rich repeat 54..77 CDD:275378 2/23 (9%)
LRR 1 54..77 2/23 (9%)
LRR_8 76..133 CDD:316378 17/84 (20%)
leucine-rich repeat 78..101 CDD:275378 3/23 (13%)
LRR 2 78..101 3/23 (13%)
leucine-rich repeat 102..122 CDD:275378 8/41 (20%)
LRR 3 102..122 8/41 (20%)
leucine-rich repeat 123..147 CDD:275378 11/55 (20%)
LRR 4 123..147 11/55 (20%)
LRR 5 148..168 10/26 (38%)
leucine-rich repeat 148..161 CDD:275378 6/13 (46%)
LRR 6 169..196 7/29 (24%)
leucine-rich repeat 174..196 CDD:275380 6/24 (25%)
LRR 7 197..219 8/41 (20%)
LRR 8 220..250 6/30 (20%)
LRR 9 251..277 5/26 (19%)
LRR 10 278..303 10/41 (24%)
LRR 11 304..330 7/45 (16%)
LRR 12 331..354 4/23 (17%)
PLN00113 <353..>565 CDD:331614 53/243 (22%)
LRR 13 355..378 3/23 (13%)
leucine-rich repeat 379..404 CDD:275380 7/29 (24%)
LRR 14 379..404 7/29 (24%)
leucine-rich repeat 405..429 CDD:275380 8/34 (24%)
LRR 15 405..429 8/34 (24%)
leucine-rich repeat 430..451 CDD:275380 6/21 (29%)
LRR 16 430..450 5/20 (25%)
LRR 17 451..474 6/33 (18%)
leucine-rich repeat 452..474 CDD:275380 5/32 (16%)
leucine-rich repeat 475..497 CDD:275380 5/22 (23%)
LRR 18 475..496 5/21 (24%)
LRR 19 497..520 6/26 (23%)
leucine-rich repeat 499..520 CDD:275380 5/24 (21%)
LRRCT 529..582 CDD:214507 13/57 (23%)
TIR 641..780 CDD:214587 51/141 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.