DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and cd180

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001297419.1 Gene:cd180 ZFINID:ZDB-GENE-070705-323 Length:665 Species:Danio rerio

Alignment Length:680 Identity:164/681 (24%)
Similarity:260/681 (38%) Gaps:184/681 (27%)


  Fly    34 CSEMSIDGLCQCAPIMSEYEII------CPANAENPTFRLTIQPKDYVQIMCNLT----DTTDYQ 88
            |::|.:..:....|  :..:|:      .|| ..|.||:.....:......|::|    |...||
Zfish    41 CNDMDLQSIPDEIP--NSVQILQFSFNYLPA-LYNSTFQRLKSLRSLDVTRCSITFIYEDVFTYQ 102

  Fly    89 QLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFE---SDNLG----MNITRQHL 146
            ...:.|.:.....|.:......|  |:|  |.||.:|........   |:||.    :::...::
Zfish   103 PHLEVLLLTGNPLVFIASTAFSG--PLA--LKYLSLVQSKIKQLSDIPSENLAYLEVLDLRGSNI 163

  Fly   147 DRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLE---NLE--SIEFGS 206
            ..|:||..||:                :||..|:|..|..:..|  |:||:   ||.  ||.|..
Zfish   164 RSLNGLSNFRW----------------QNLKSLQLDLNFIDRIS--FNDLQPFSNLAGVSISFKG 210

  Fly   207 NKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGID--------IHDN----GIEQ 259
            |....:..|.|..:              ||:..||.|..:.:.|.        |..|    |:.:
Zfish   211 NDFIYIEPGAFHSL--------------NLSSLDFSGCLNKMNISSLLKGLEGIKTNRLNLGLYE 261

  Fly   260 LPHDVF---AHLTN-----VTDINLSANLFRSLPQGLFDH-----------NKHLNEVRLMNNRV 305
            ...:|:   |.|.:     |:|::.....|..|....| |           ..|||.:.|  |..
Zfish   262 TDSNVYIASAALQSFCNIFVSDLDFQLQHFLDLNNSTF-HCLEGLKKLDLTRAHLNALPL--NTT 323

  Fly   306 PLATLPSRLFANQPELQILRLRAELQSLPGDLFEHSTQ----ITNISLGDNLLK-TLPATLLEHQ 365
            .|:|| |.|..::.:.:             |:.:.:|:    :|::|:..||.| |.....|:..
Zfish   324 GLSTL-SHLILDENQFK-------------DVCQSNTRNFPMLTHLSISGNLKKLTFSNRCLDSL 374

  Fly   366 VNLLSLDLS-----------NNRLTHLPD----------------SLFAHTTNLTDLRLEDNLLT 403
            ..|..||||           ||:|..|.:                ..|..|..|..|....::.|
Zfish   375 GLLEELDLSVSLVNPREPCCNNQLFGLGELKLLNLSYGSPMFWSSKPFNVTPKLEHLDFSHSVYT 439

  Fly   404 GIS-GDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQINS 467
            .:: ...||||.:|.||.:|.:.....:...||....|:||:|..|.|.     .:::.||::  
Zfish   440 LLNDSSPFSNLQSLRTLNLSWSNTDLTNVHLFVGLKALQHLNLRGNAIQ-----GEVLTQTEL-- 497

  Fly   468 PFGYMHGLLTLNLRNNSII-FVYNDWKNTMLQLRELDLSYN---NISSLGYEDLAFLSQNRLHVN 528
             |..:..|.||.|....|. |..|.:|. :..|..:|||.|   .:|:.|:..|.||.     :|
Zfish   498 -FKCVPLLETLVLSACKITSFDENLFKG-LRHLNHIDLSENKFVKLSTSGFYSLDFLK-----LN 555

  Fly   529 MTHNKIRRIALPEDVHLGEGYNNNLVHVDLNDNPLVCDCTILWFIQLVRGVHKPQYSRQFKLRTD 593
            ...|.|..:.:.....|||..:     |||:.|||||:|:...||..|         ::.|::..
Zfish   556 FARNDITTVDVASVADLGEEGS-----VDLSYNPLVCNCSNFEFIHWV---------KKNKVKVK 606

  Fly   594 RLV---CSQPNVLEGTPVRQIEPQTLICPL 620
            .|:   |:      ||..|.|:.: |.|.|
Zfish   607 HLMETFCN------GTGTRIIDAK-LQCDL 629

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 17/64 (27%)
leucine-rich repeat 176..198 CDD:275380 8/25 (32%)
leucine-rich repeat 199..222 CDD:275380 7/25 (28%)
LRR_RI 216..542 CDD:238064 92/394 (23%)
LRR_8 221..281 CDD:290566 14/80 (18%)
leucine-rich repeat 223..270 CDD:275380 12/62 (19%)
leucine-rich repeat 271..294 CDD:275380 6/34 (18%)
leucine-rich repeat 295..320 CDD:275380 9/25 (36%)
leucine-rich repeat 321..343 CDD:275380 2/22 (9%)
LRR_8 342..402 CDD:290566 21/92 (23%)
leucine-rich repeat 344..367 CDD:275380 7/24 (29%)
leucine-rich repeat 368..391 CDD:275380 11/50 (22%)
LRR_8 390..450 CDD:290566 18/61 (30%)
leucine-rich repeat 392..415 CDD:275380 7/24 (29%)
leucine-rich repeat 416..439 CDD:275380 6/23 (26%)
leucine-rich repeat 440..474 CDD:275380 9/34 (26%)
leucine-rich repeat 475..498 CDD:275380 8/24 (33%)
LRR_8 477..534 CDD:290566 19/61 (31%)
leucine-rich repeat 499..520 CDD:275380 9/24 (38%)
leucine-rich repeat 523..552 CDD:275380 6/29 (21%)
LRRCT 561..619 CDD:214507 18/61 (30%)
LRRNT 631..667 CDD:214470
leucine-rich repeat 664..693 CDD:275380
LRR_8 669..726 CDD:290566
leucine-rich repeat 694..715 CDD:275380
leucine-rich repeat 716..737 CDD:275380
LRRCT 751..800 CDD:214507
TIR 858..996 CDD:214587
cd180NP_001297419.1 leucine-rich repeat 40..56 CDD:275380 3/17 (18%)
LRR_8 56..115 CDD:316378 12/60 (20%)
leucine-rich repeat 57..80 CDD:275380 6/24 (25%)
leucine-rich repeat 81..104 CDD:275380 5/23 (22%)
LRR_8 103..163 CDD:316378 12/64 (19%)
leucine-rich repeat 105..128 CDD:275380 4/25 (16%)
leucine-rich repeat 153..176 CDD:275380 5/39 (13%)
leucine-rich repeat 177..200 CDD:275380 8/25 (32%)
leucine-rich repeat 201..225 CDD:275380 7/38 (18%)
leucine-rich repeat 226..247 CDD:275380 5/21 (24%)
leucine-rich repeat 284..304 CDD:275378 4/21 (19%)
leucine-rich repeat 305..327 CDD:275380 6/24 (25%)
leucine-rich repeat 328..351 CDD:275380 5/37 (14%)
leucine-rich repeat 352..376 CDD:275380 7/24 (29%)
leucine-rich repeat 404..427 CDD:275380 2/23 (9%)
LRR_8 426..487 CDD:316378 18/61 (30%)
leucine-rich repeat 428..452 CDD:275380 7/24 (29%)
leucine-rich repeat 453..476 CDD:275380 6/23 (26%)
leucine-rich repeat 477..503 CDD:275380 9/34 (26%)
LRR_8 502..561 CDD:316378 20/65 (31%)
leucine-rich repeat 504..527 CDD:275380 8/24 (33%)
leucine-rich repeat 528..549 CDD:275380 7/21 (33%)
leucine-rich repeat 552..574 CDD:275380 6/27 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.