DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and tlr7

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:XP_021334735.1 Gene:tlr7 ZFINID:ZDB-GENE-040219-11 Length:1036 Species:Danio rerio

Alignment Length:1172 Identity:245/1173 (21%)
Similarity:440/1173 (38%) Gaps:376/1173 (32%)


  Fly     7 ASELALLVIILQLLQW-PGS---EASFGRDACSEMSIDGLCQCAP-IMSEYEIICPANAENPTFR 66
            ||.::|||    ..:| |.|   :.|...:. :|:|:|    |.. .::|..:..|.|..|.|..
Zfish    10 ASFISLLV----AAEWYPKSLKCDVSLASNG-TEVSVD----CTERSLTEVPLGIPTNTTNLTLT 65

  Fly    67 LTIQPKDYVQIMCNLTDTTDYQQ----LPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSP 127
            :...|........||.:.|:...    :|  :::|..|||    |                    
Zfish    66 INHIPHVMNNSFDNLHNITEIDLRCNCVP--VKVGPKDRV----C-------------------- 104

  Fly   128 TTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANL---------------------LT 171
                    :..::|......:|..||.......:|:.||..|                     ||
Zfish   105 --------SQSVSIDNGTFWKLKNLKSLYLDGNQLSSIPKGLPANIVLLSLEINSIYSILQENLT 161

  Fly   172 DMRNLSHLELRAN------------IEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMP-KL 223
            ::.|:..|.|..|            ||:   ..|..|:.:..:...||.|..:|    .::| .|
Zfish   162 ELTNIRTLYLGQNCYFRNPCNQSYYIEK---DAFMLLDKMTLLSLKSNNLSYIP----NQLPSSL 219

  Fly   224 KQLNLWSNQLHNLTKHDFEGATSVLGID------------------------------------- 251
            |:|.|::|.:..:|::||...|.:..:|                                     
Zfish   220 KELYLYNNNIEKITENDFCNLTELEVLDLSGNCPRCYNAPFPCIPCPNNAPLQIHPNSFKTLRNL 284

  Fly   252 ----IHDNGIEQLPHDVFAHLTNVTDINLSANLF------RSLPQGLFDHNKHLNEVRLMNNRVP 306
                :|.|.:..:|.:.|..|.::|.::||:|..      .|.|..|    ..|.|:.|..| ..
Zfish   285 KTLRLHSNSLTNIPPEWFQSLADLTLLDLSSNFLAKEITCTSFPSLL----PKLEELDLSFN-YE 344

  Fly   307 LATLPSRL-----FANQPELQILRLRA----ELQSLPGDLFEHSTQITNISLGDNLLKTLPATLL 362
            |...|:.|     |:....|::||:|.    ||:........:.|.:..:.||.|.:|....::|
Zfish   345 LQVYPASLSLSESFSQLKSLRVLRIRGYVFQELKLQDIQPLTNLTYLEFLDLGTNFIKIAQLSIL 409

  Fly   363 EHQVNLLSLDLSNNRLTHLPDSLFA-------------------HTTNLTDL------------R 396
            ::..|...::||:|:::...:..|:                   |...:.|:            :
Zfish   410 KNLKNFKIINLSDNKISVPSEGEFSFSNHREAYYGSPMSQGAQYHNGEVKDMHYFLYDEFARSCK 474

  Fly   397 LEDNLL------------TGISGDI-----------FSNLGNLVTLVMSRNRL-RTIDSRAFVST 437
            .:|..|            .|.:.||           |.|||.|..|.:|.|.: ::::...||..
Zfish   475 YKDKELWIPSPFNNDCSSFGKTLDISRNNIFFLHSKFLNLGELRCLNLSGNAMSQSLNGSEFVQL 539

  Fly   438 NGLRHLHLDHNDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVYN------DWKNTM 496
            ..|::|....|.:||..|           |.|..:..|:.|::..||..||..      ::...:
Zfish   540 TNLQYLDFTDNRLDLMYP-----------SAFQELSNLVVLDISRNSHYFVAEGLTHMLNFTENL 593

  Fly   497 LQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIALPEDVHLGEGYNN--NLVHVDLN 559
            .:||:|.::.|.||:....::.  |....|:....|::..:....|......:.|  :|..:|::
Zfish   594 SKLRKLIMNDNQISTSTNTEMK--SYKLEHLEFKGNRLDMLWRDGDTRYVNYFKNLMSLKTLDIS 656

  Fly   560 DNPLVCDCTILWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQTLICPLDFSD 624
            .|.|.       ||.||                         |.:|.|       ..:..|..:|
Zfish   657 RNNLN-------FIPLV-------------------------VFQGLP-------NTLTKLYITD 682

  Fly   625 DPRERKCPRGCNCHVRTYDKALVINCHSGN-LTHVPR-LPNLHKNMQLMELHLENNTLLRLPSAN 687
            :..:.....|.     .|.|:|::...:|| ||.||. |.|..|::|  .|.|..|.:::|....
Zfish   683 NKLKLFKWEGL-----VYLKSLLLLDLTGNLLTEVPSCLSNYTKSIQ--TLVLSKNKIVKLSPNF 740

  Fly   688 TPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLSGNP 752
            .....|:..|.|:.|::..||....|.|:.      :|||.|      :||..|           
Zfish   741 LKDAFSLKILDLSYNSIQFIDESSFPENVI------DHLQTL------YLNNNM----------- 782

  Fly   753 WMCDCTAKPLLLF---TQDNFERIGDRNEMMCVNAEMPTRMVELSTNDICPAEKG---VFI---- 807
            ::|.|.|..|:.:   |..|..|:.  :::.|.:..               |:||   :|:    
Zfish   783 FVCSCNATWLVRWINRTSVNIPRLA--SDVTCASPS---------------AQKGQSVIFLNLQA 830

  Fly   808 ----ALAVVIALTGLLAGFTAALYYKFQTE-----IKIWLYAHNLL--LWFVTEEDLDKDK---- 857
                :|::::.:              |||.     :.:.:.:|..|  :|::....|.|.|    
Zfish   831 CQHNSLSIILCI--------------FQTTLILTILTLTISSHLFLWDVWYIYHFCLAKLKGYRR 881

  Fly   858 ------KFDAFISYSHKDQSFIEDYLVPQL-----EHGPQKFQLCVHERDWLVGGHIPENIMRSV 911
                  .:|||:.|...|.: ::::::.:|     :.|..:..||:.||||:.|..:.||:.:|:
Zfish   882 LSSNSAVYDAFVIYDTTDPA-VQEWVMQELRVHLEDKGDPRMNLCLEERDWVPGCPLIENLSQSI 945

  Fly   912 ADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGDVEKLDEELKAYLKMNT 976
            ..|:||:.:|::.:|:|...|..|..||:..::| |:.:||:|:     :|::....| ||::..
Zfish   946 QLSQRTVFILTERYIRSGSFRTAFYLAHQRLMDE-RNDVIVLIF-----LERMPCHSK-YLRLRK 1003

  Fly   977 YL 978
            .|
Zfish  1004 RL 1005

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 18/72 (25%)
leucine-rich repeat 176..198 CDD:275380 7/34 (21%)
leucine-rich repeat 199..222 CDD:275380 5/24 (21%)
LRR_RI 216..542 CDD:238064 88/444 (20%)
LRR_8 221..281 CDD:290566 20/102 (20%)
leucine-rich repeat 223..270 CDD:275380 15/88 (17%)
leucine-rich repeat 271..294 CDD:275380 7/29 (24%)
leucine-rich repeat 295..320 CDD:275380 8/30 (27%)
leucine-rich repeat 321..343 CDD:275380 7/26 (27%)
LRR_8 342..402 CDD:290566 14/91 (15%)
leucine-rich repeat 344..367 CDD:275380 5/23 (22%)
leucine-rich repeat 368..391 CDD:275380 5/42 (12%)
LRR_8 390..450 CDD:290566 19/96 (20%)
leucine-rich repeat 392..415 CDD:275380 10/58 (17%)
leucine-rich repeat 416..439 CDD:275380 6/24 (25%)
leucine-rich repeat 440..474 CDD:275380 8/34 (24%)
leucine-rich repeat 475..498 CDD:275380 6/29 (21%)
LRR_8 477..534 CDD:290566 14/63 (22%)
leucine-rich repeat 499..520 CDD:275380 6/21 (29%)
leucine-rich repeat 523..552 CDD:275380 4/31 (13%)
LRRCT 561..619 CDD:214507 9/58 (16%)
LRRNT 631..667 CDD:214470 13/38 (34%)
leucine-rich repeat 664..693 CDD:275380 6/29 (21%)
LRR_8 669..726 CDD:290566 14/57 (25%)
leucine-rich repeat 694..715 CDD:275380 6/21 (29%)
leucine-rich repeat 716..737 CDD:275380 4/21 (19%)
LRRCT 751..800 CDD:214507 8/52 (15%)
TIR 858..996 CDD:214587 37/127 (29%)
tlr7XP_021334735.1 LRR_8 67..131 CDD:316378 14/98 (14%)
leucine-rich repeat 83..120 CDD:275380 9/71 (13%)
PLN00113 107..>574 CDD:331614 97/490 (20%)
leucine-rich repeat 121..165 CDD:275380 8/44 (18%)
leucine-rich repeat 142..157 CDD:275380 0/15 (0%)
leucine-rich repeat 166..197 CDD:275380 7/34 (21%)
leucine-rich repeat 199..218 CDD:275380 5/23 (22%)
leucine-rich repeat 219..242 CDD:275380 9/23 (39%)
leucine-rich repeat 243..283 CDD:275380 1/40 (3%)
leucine-rich repeat 284..307 CDD:275380 5/23 (22%)
leucine-rich repeat 308..333 CDD:275380 7/29 (24%)
leucine-rich repeat 334..363 CDD:275380 8/30 (27%)
leucine-rich repeat 364..390 CDD:275380 7/26 (27%)
leucine-rich repeat 391..414 CDD:275380 5/23 (22%)
leucine-rich repeat 415..434 CDD:275380 4/19 (21%)
leucine-rich repeat 495..516 CDD:275380 6/21 (29%)
leucine-rich repeat 517..541 CDD:275380 6/24 (25%)
leucine-rich repeat 542..565 CDD:275380 8/34 (24%)
leucine-rich repeat 566..595 CDD:275380 6/29 (21%)
leucine-rich repeat 596..616 CDD:275380 6/22 (27%)
leucine-rich repeat 619..649 CDD:275380 4/30 (13%)
LRR_8 <644..685 CDD:316378 14/80 (18%)
leucine-rich repeat 650..673 CDD:275380 11/62 (18%)
leucine-rich repeat 675..722 CDD:275380 15/52 (29%)
LRR_8 722..781 CDD:316378 19/73 (26%)
leucine-rich repeat 723..746 CDD:275380 5/25 (20%)
leucine-rich repeat 747..765 CDD:275380 5/18 (28%)
PCC 751..>828 CDD:188093 25/117 (21%)
TIR 889..>993 CDD:214587 33/111 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.