DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and tlr9

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:XP_017948709.1 Gene:tlr9 XenbaseID:XB-GENE-486908 Length:1030 Species:Xenopus tropicalis

Alignment Length:1112 Identity:231/1113 (21%)
Similarity:400/1113 (36%) Gaps:341/1113 (31%)


  Fly    45 CAPI-MSEYEIICPANAENPTFRLTIQPKDYVQI--MCNL----TDTTDYQQLPKKLRIGEVDRV 102
            |.|. :..|:.||         ||.|:|...|.:  :.||    ...|....||:.::...::..
 Frog    97 CQPSNLRPYKEIC---------RLIIEPHALVSLKSLTNLDLSGNSLTSIPPLPENIKFLNLNLN 152

  Fly   103 QMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMN-----------------ITRQHLDRLH 150
            |:.  |:.|..  .|.|:.:.::          .||.|                 |..:.|:.| 
 Frog   153 QIH--MISGWE--FSRLNNVKMI----------RLGYNCFYSKQCEPFHLSDSAFINNEFLEEL- 202

  Fly   151 GLKRFRFTTRRLTHIPANLLTDMRNLSHLELRAN-IEEMPSHLFDDLENLESIEF---------- 204
                 ..:...:|..|.||.:.:|   .|:|..| |.::......:|.||.|::.          
 Frog   203 -----ALSFNNITSFPQNLPSSIR---ILDLSENKISKIDREDLCNLNNLHSLDLQWNCQRCDHA 259

  Fly   205 --------GSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLP 261
                    .::.|..:| |:|..:.||..|||..|.||.|....|...|::..:.:.||.:....
 Frog   260 LQACYPCKNNSALLLVP-GVFDCLHKLSYLNLRGNSLHTLHSSLFSSLTNLSHLVLSDNFLNLET 323

  Fly   262 HDVFAHLTNVTDINLSANLFRSLPQGLFD---------HNKHLNEVRLM---------NNRVPLA 308
            ...|:.||||.::||..| |:  |..:::         ..|.|..:.::         ...:||.
 Frog   324 ETFFSALTNVKELNLDFN-FK--PYSMYERLVLNSNVARMKSLERITIVGYFFNVLDEEGIMPLL 385

  Fly   309 TLP-----------------SRLFANQPELQILRLRAELQS-----------LPGDLFEHSTQIT 345
            :||                 |.||.::| |:.:.|...|.|           :...||:...|:.
 Frog   386 SLPNLREISLRTNFILKVNLSMLFTHKP-LRFISLSENLISFEEHKHGQKLAMHPPLFDRGNQVD 449

  Fly   346 NISLGDNL-LKTLPATLLEH----QVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLEDNLLT-G 404
            ...:..:. .|.:.|..:|:    |.| .|:|||.|.:..:....|.....:..|.:..|.:. .
 Frog   450 GGWMDSHCGPKQVEAGEVEYPGCWQYN-HSVDLSFNNIGSIYPDEFLGMDEIECLNMSYNYINQR 513

  Fly   405 ISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDHND-----------IDLQQPLLD 458
            ::|..|.:|.:|..|.:|.||......:|......|:.|:|.|||           :|..:.|..
 Frog   514 LNGTQFGHLKSLRHLDLSHNRFDMYYYKALSELPRLKILNLAHNDYQFMMKGVNHRLDFLENLTS 578

  Fly   459 IMLQTQINSPFGYM--------HGLLTLNLRNNSIIFVYNDWKNTML-------QLRELDLSYNN 508
             :::..:|:.|..:        |.|.||..|||.:...:...|:|.|       .|:.||:|||.
 Frog   579 -LVELNLNNNFIGLRITRELKSHSLETLRFRNNELGSSWQYGKDTYLNMFTNLRSLKILDISYNQ 642

  Fly   509 ISSLGYEDLAFLSQNRLHVNMTHNKIRRIALPEDVHLGEGYNNNLVHVDLNDNPLVCDCTILWFI 573
            :..:..|.|..|.::...:|::|||:......:..|||     ||..:||..|.|.         
 Frog   643 LPVIPNEVLEKLPESLQKLNLSHNKLYTFNWAKTAHLG-----NLAILDLGFNALT--------- 693

  Fly   574 QLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCH 638
                           |||                                               
 Frog   694 ---------------KLR----------------------------------------------- 696

  Fly   639 VRTYDKALVINCHSGNLTHVPRLPNLHKNMQLMELHLENNTLLRLPSANTPGYESVTSLHLAGNN 703
                          .|||          ...:..|:|..|.:..|.......:..:..|.|:.|.
 Frog   697 --------------ANLT----------ESNIAFLNLTYNKINSLDKDFFDSFSELKQLILSNNL 737

  Fly   704 LTSIDVDQLPTN-LTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLSGNPWMCDCTAKPLLLFTQ 767
            :.:|.:...|.| |.:||                        |:.:||||:.|.|.|...:.|..
 Frog   738 IKTIHITSFPINFLQNLD------------------------SLDVSGNPFQCTCKAYWFITFLM 778

  Fly   768 DNFERIGDRNEMMCVNAEMPTRMVELSTND----------ICPAEKGVFIALAVVIALTGLLAGF 822
            :....:...:..|..::....|...|.:.|          :|      ||..::::....::...
 Frog   779 ETEVTVDHLSTGMKCDSPDSLRGRSLLSMDPQSCQELYGHVC------FIWSSILVIFLMVIPTI 837

  Fly   823 TAALYYKFQTEIKIWLYAHNLLLWFVTEEDLDKDKK---FDAFISYSHKDQS---FIEDYLVPQL 881
            ....::      .:| ||.:|::..:.......||.   |||||:::.|:.|   ::.:.|:.||
 Frog   838 WNLFFW------NLW-YAGHLIVATLRSYTKLHDKSTEHFDAFIAFNTKNSSVRDWVYNELLVQL 895

  Fly   882 EHGPQK--FQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALN 944
            | .|::  |.||:.||||:.|....||:..|:..|::||.::::.:......|..|..:::..|:
 Frog   896 E-SPERGGFTLCLEERDWIAGRSSIENLYDSIYRSKKTIFIITREWFNCGLLRHAFFMSNQRLLD 959

  Fly   945 EGRSRIIVIIYSDIGDVEKLDEELK--------AYLKMNTYLKW-----GDPWFWDKLRFAL--P 994
            |.:..:.:::         ||.::|        ..|...::|.|     ....||..||..:  .
 Frog   960 EKKDVVALVV---------LDHKMKMSQYFLTRKRLCPKSFLNWPCNPKAHSHFWHMLRIYIRQD 1015

  Fly   995 HRRPVGN 1001
            .||..|:
 Frog  1016 SRRCCGS 1022

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 19/78 (24%)
leucine-rich repeat 176..198 CDD:275380 5/23 (22%)
leucine-rich repeat 199..222 CDD:275380 6/41 (15%)
LRR_RI 216..542 CDD:238064 96/404 (24%)
LRR_8 221..281 CDD:290566 21/60 (35%)
leucine-rich repeat 223..270 CDD:275380 15/47 (32%)
leucine-rich repeat 271..294 CDD:275380 7/32 (22%)
leucine-rich repeat 295..320 CDD:275380 9/51 (18%)
leucine-rich repeat 321..343 CDD:275380 6/33 (18%)
LRR_8 342..402 CDD:290566 14/65 (22%)
leucine-rich repeat 344..367 CDD:275380 4/28 (14%)
leucine-rich repeat 368..391 CDD:275380 6/23 (26%)
LRR_8 390..450 CDD:290566 17/72 (24%)
leucine-rich repeat 392..415 CDD:275380 5/24 (21%)
leucine-rich repeat 416..439 CDD:275380 6/23 (26%)
leucine-rich repeat 440..474 CDD:275380 11/53 (21%)
leucine-rich repeat 475..498 CDD:275380 9/30 (30%)
LRR_8 477..534 CDD:290566 21/64 (33%)
leucine-rich repeat 499..520 CDD:275380 8/21 (38%)
leucine-rich repeat 523..552 CDD:275380 7/29 (24%)
LRRCT 561..619 CDD:214507 5/58 (9%)
LRRNT 631..667 CDD:214470 3/36 (8%)
leucine-rich repeat 664..693 CDD:275380 4/29 (14%)
LRR_8 669..726 CDD:290566 13/58 (22%)
leucine-rich repeat 694..715 CDD:275380 5/21 (24%)
leucine-rich repeat 716..737 CDD:275380 3/21 (14%)
LRRCT 751..800 CDD:214507 11/59 (19%)
TIR 858..996 CDD:214587 40/161 (25%)
tlr9XP_017948709.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.