DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and tlr2

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:XP_002933537.1 Gene:tlr2 XenbaseID:XB-GENE-481145 Length:780 Species:Xenopus tropicalis

Alignment Length:860 Identity:198/861 (23%)
Similarity:343/861 (40%) Gaps:211/861 (25%)


  Fly   248 LGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATLPS 312
            |.:.:...|....|.|. ||..:.:.::     :.::|.||....:.||   |.:|.:.:.|   
 Frog    14 LVVTVLSKGNTDCPCDA-AHFCHCSSMH-----WEAIPSGLPRDVRGLN---LSSNAIQIVT--- 66

  Fly   313 RLFANQPELQILRLRAELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNR 377
                 :.:||           |.|      |:..:.|..|.:.|:.....:...||..||||.|.
 Frog    67 -----ETDLQ-----------PYD------QLQTLLLQYNAIHTINDGSFQPLGNLEELDLSYNN 109

  Fly   378 LTHLPDSLFAHTTNLTDLRLEDN-LLTGISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLR 441
            |:||..:.|.:..||..|.|..| .||..:..:|::|.:|.:|.........|....|.|...|.
 Frog   110 LSHLSSAWFRNLYNLKHLNLLGNQYLTLGNNSLFASLSSLRSLQFGNQDFSAIQKLHFESLERLN 174

  Fly   442 HLHLDHNDIDLQQ--PLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVYNDWKN--TMLQLREL 502
            .|.:....:.|.:  .|..|   .|||      |.:||:|::|  :..:.||:.:  |:|:::::
 Frog   175 ILEIKAAQLGLYEEGSLAAI---KQIN------HAVLTVNIQN--LRALLNDFVHSVTLLEMKDM 228

  Fly   503 D------------LSYNNISSLGYEDLAFLSQNR---LHVNMTHNKIRRIALPEDVHLGEGYNNN 552
            .            |:..:|..|.:.:.....|:.   |.:..|:..|....|.:....|.|..:.
 Frog   229 QFGDAADVKAMVILNDTSIKYLVFRNCIITDQSASRLLEIFQTYRNITDFILDDSTLYGTGTASP 293

  Fly   553 LVHVDLNDNPLVCDCTIL--------WFIQLVRGVHK------------------P-QYSRQF-- 588
            ::    .|:|......|:        :....::|::|                  | .:||.|  
 Frog   294 VI----GDDPFSVTTAIINKLHIPKFFLFSDLQGIYKLASNFKNIACIDSKVFLMPCAFSRSFSS 354

  Fly   589 --------KLRTDRLVCSQPNVLEG-----------------TPVRQIEPQT----LICPLDFSD 624
                    .|.:|.|:.|.....||                 |.:|::...|    .:..||.|.
 Frog   355 LQYLDLSGNLLSDNLLASSACAFEGGGAWPILQTLNVSRNLLTSLRRLAQITSGLKYLTNLDVSQ 419

  Fly   625 DPRERKCPRGCNCHVRTYDKAL----VINCHSGNLTHVP------------------RLPNLHKN 667
            :.........|.     :.|:|    :.:....|:|.:|                  ::||    
 Frog   420 NNFGELSTSTCQ-----WPKSLKYLNISSSQMSNITCIPPTLQILDVSSNYLTVFTIKMPN---- 475

  Fly   668 MQLMELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSI---DVDQLPTNLTHLDISWNHLQML 729
              |.||::.||.|.:||....  :..:..|.:..|.|...   |:|..| .||.||...|: .:.
 Frog   476 --LTELYISNNRLSKLPEGMY--FPRLFMLSIDRNKLNDFYQSDLDLFP-QLTTLDGRDNN-YLC 534

  Fly   730 NATVLGFLNRTMKWRSVKLSGNP--WMCDCTAKPLLLFTQDNFERIGDRN--EMMCVNAEMPTRM 790
            :...|.|::.    .::.|.|.|  ::||..:..       ..:||.|.|  .::|    ..|.:
 Frog   535 SCQFLSFMHS----HTIALVGWPDDYICDSPSSV-------RGKRIQDANLPPLVC----HKTLI 584

  Fly   791 VELSTNDICPAEKGVFIALAVVIALTGLLAGFTAALYYKFQTEIKIWLYAHNLLLWFVTEEDLDK 855
            |.||    |       |.|..::|....|..|...::|...|  ..||.|....|     ::.|:
 Frog   585 VTLS----C-------ILLIALVAAIAALCHFLHVVWYAKMT--WAWLKAKRKPL-----KNCDR 631

  Fly   856 DKKFDAFISYSHKDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIV 920
            :..::.|:|||.:|..::|:.:||:||:.....:||:|:||::.|..|.:||:.::..|.:|:.|
 Frog   632 EICYNGFVSYSERDSEWVENMMVPKLENAVPPMKLCLHKRDFVPGKWIIDNIIDAMEKSYKTVFV 696

  Fly   921 LSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGD--VEKLDEELKAYLKMNTYLKW--- 980
            ||::|::|||.:.|...:|....:|.....|:|:...|.:  |.|...:|:..:...|||:|   
 Frog   697 LSEHFVRSEWCKYELEFSHFRLFDENNDSAILILLEPIENETVPKRFCKLRKLMNTKTYLEWPTD 761

  Fly   981 --GDPWFWDKLRFAL 993
              ....|||.|:.||
 Frog   762 EEQQEVFWDNLKTAL 776

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566
leucine-rich repeat 176..198 CDD:275380
leucine-rich repeat 199..222 CDD:275380
LRR_RI 216..542 CDD:238064 72/314 (23%)
LRR_8 221..281 CDD:290566 6/33 (18%)
leucine-rich repeat 223..270 CDD:275380 6/22 (27%)
leucine-rich repeat 271..294 CDD:275380 3/23 (13%)
leucine-rich repeat 295..320 CDD:275380 5/25 (20%)
leucine-rich repeat 321..343 CDD:275380 4/22 (18%)
LRR_8 342..402 CDD:290566 20/61 (33%)
leucine-rich repeat 344..367 CDD:275380 3/23 (13%)
leucine-rich repeat 368..391 CDD:275380 10/23 (43%)
LRR_8 390..450 CDD:290566 16/61 (26%)
leucine-rich repeat 392..415 CDD:275380 8/24 (33%)
leucine-rich repeat 416..439 CDD:275380 5/23 (22%)
leucine-rich repeat 440..474 CDD:275380 9/36 (25%)
leucine-rich repeat 475..498 CDD:275380 8/25 (32%)
LRR_8 477..534 CDD:290566 13/74 (18%)
leucine-rich repeat 499..520 CDD:275380 3/33 (9%)
leucine-rich repeat 523..552 CDD:275380 6/32 (19%)
LRRCT 561..619 CDD:214507 17/116 (15%)
LRRNT 631..667 CDD:214470 8/58 (14%)
leucine-rich repeat 664..693 CDD:275380 8/29 (28%)
LRR_8 669..726 CDD:290566 19/60 (32%)
leucine-rich repeat 694..715 CDD:275380 6/24 (25%)
leucine-rich repeat 716..737 CDD:275380 7/21 (33%)
LRRCT 751..800 CDD:214507 13/53 (25%)
TIR 858..996 CDD:214587 47/144 (33%)
tlr2XP_002933537.1 leucine-rich repeat 55..75 CDD:275378 9/48 (19%)
LRR_8 75..133 CDD:290566 20/58 (34%)
leucine-rich repeat 76..99 CDD:275378 3/23 (13%)
LRR_RI 100..367 CDD:238064 61/282 (22%)
leucine-rich repeat 100..123 CDD:275378 10/23 (43%)
leucine-rich repeat 124..148 CDD:275378 8/24 (33%)
leucine-rich repeat 149..162 CDD:275378 2/13 (15%)
LRR_RI 316..510 CDD:238064 37/207 (18%)
leucine-rich repeat 322..352 CDD:275378 5/30 (17%)
leucine-rich repeat 355..382 CDD:275380 6/27 (22%)
leucine-rich repeat 386..411 CDD:275380 3/25 (12%)
leucine-rich repeat 412..435 CDD:275380 5/28 (18%)
leucine-rich repeat 436..455 CDD:275380 4/19 (21%)
LRR_8 454..508 CDD:290566 12/62 (19%)
leucine-rich repeat 456..475 CDD:275380 1/19 (5%)
leucine-rich repeat 476..497 CDD:275380 8/23 (35%)
leucine-rich repeat 498..521 CDD:275380 6/24 (25%)
TIR 634..779 CDD:214587 47/144 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.