DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and LOC100485706

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:XP_002942581.1 Gene:LOC100485706 XenbaseID:XB-GENE-5905045 Length:944 Species:Xenopus tropicalis

Alignment Length:1043 Identity:230/1044 (22%)
Similarity:373/1044 (36%) Gaps:331/1044 (32%)


  Fly   138 GMNITRQHLDRLHGLKRFRFTTRRLTHIPANL--LTDMRNLSHLELRANIEEMPSHL-FDDLENL 199
            |..:.||     :.||...: .|.||.:||.|  |:.|.:|||     ||.:..:.. |.:|..|
 Frog    33 GCEVHRQ-----YNLKVLCY-NRDLTKVPAQLPELSFMLDLSH-----NIIKTINRTDFQNLTVL 86

  Fly   200 ESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHDV 264
            :::...:|.::.|..|.|||:..|:.|||..|::.:|:...|||..::..:.:.:|.|..|..:.
 Frog    87 QNLNLSNNHIQYMENGAFGKLVALQLLNLTKNRIGSLSSRTFEGLQNLSTLLLDNNNIVTLEPNT 151

  Fly   265 FAHLTNVTDINLSANLFRSL--------------------------PQGLFDHNKHLNEVRLMNN 303
            |.||.|:..|:||.|.|..|                          .:.:.:.:..|..|....|
 Frog   152 FLHLYNLKTISLSYNCFYKLKTLNPAFQIGTLREINIANCSIQTFSTEDIVNVSASLRSVDASRN 216

  Fly   304 RVPLATLPSRLFAN--------------------------------------------------- 317
            ...:.:.|..:..|                                                   
 Frog   217 PFSVISFPMSILENLTNLDISLTQRPILWYVKEPCFLRGLKKLNIKENNIKPPAIIGIIKNLSCS 281

  Fly   318 -------------------------QPELQILRLRA-------------------------ELQS 332
                                     .|::|.|:|..                         .|.|
 Frog   282 SLEELNLSYLNLTDSDQLIQELCLRHPKVQTLKLTGNQYTEFREDTFQNCTSVKVLDLSHNRLHS 346

  Fly   333 LPGDLFEHSTQITNISLGDNLLKTLP---------------------ATLLEHQVNLLSLDLSNN 376
            .||..|.|...|..:||.:|.|..:|                     ..|.:...||..||||.|
 Frog   347 APGSTFHHLASIRELSLANNSLTAIPDNFSFITSLQKLNLSYNHVKEVNLNDSFSNLKELDLSGN 411

  Fly   377 RLTHLPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLR 441
            ::|....|...: .||.||.|.:|.|..||....|:|..|..|.:|:|:|.::.:..|.:...|:
 Frog   412 KMTFFLSSGLGN-WNLQDLNLRENYLLDISASFASSLPTLQRLTISKNKLSSLSTNTFQNVTFLK 475

  Fly   442 HLHLDHNDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQ----LREL 502
            ||:|..|.|::..|           ..|..:..|.||.:.:|.|  ..|...|...|    |.||
 Frog   476 HLNLADNQIEVIDP-----------GAFSGLDKLRTLIIGSNKI--TRNTLHNMTFQGLGSLLEL 527

  Fly   503 DL--SYNNISSLGYEDLA-FLSQNRLHV----NMTHNKIRRIALP--------EDVHLGEGYNNN 552
            .|  :|.|..|..|.|:. ||....|.:    :..||.::.:.:.        |.:|.|   |..
 Frog   528 QLFGNYLNYDSSNYLDIVPFLPLKSLKMITLNSQGHNGMQNLPINFFEGLLALERIHAG---NLA 589

  Fly   553 LVHVDLNDNPLVCDCTILWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQTLI 617
            |..:|                           ||.|..        .|.:.|             
 Frog   590 LSSID---------------------------SRTFSY--------TPQLRE------------- 606

  Fly   618 CPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTHVPRLPNLHKNMQLMELHLENNTLLR 682
              ||.|::|            ::..|..|..|        ||.|                     
 Frog   607 --LDISENP------------IKILDPFLFRN--------VPHL--------------------- 628

  Fly   683 LPSANTPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLDISWNHLQMLNATVLGFLNR----TMKW 743
                        |.||::...:.|:|. .:.:|||||.:    |:.:::.:..|.::    ....
 Frog   629 ------------TELHISKTRMESLDF-LILSNLTHLKL----LRAVDSQLNSFTSQQGAALPSL 676

  Fly   744 RSVKLSGNPWMCDCTAKPLLLFT-QDNFERIGDRNEMMCVNAEMPTRMVELSTNDI--CPAEKGV 805
            |.:.|..||..|.|..:..:.:. .|...::....|..|....: .|..:|||.::  |..:...
 Frog   677 RFLDLRNNPLTCICDNQWFIDWVHNDTKTQVLHFYEYTCAYPPV-ARNSKLSTFNLSSCRLDYSF 740

  Fly   806 FIALAVVIALTGLLAGFTAALYYKFQTEIKIWLYAHNLLLWFVTEEDLDKDK---KFDAFISYSH 867
            ...|...:.:|..:...|...::::..     :||:.:.|.|:........|   |:||||||:.
 Frog   741 IFFLTSTLFITTFIISATVWNFWRWHV-----IYAYYITLAFLYNRRWQGKKQKCKYDAFISYNF 800

  Fly   868 KDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWAR 932
            .|:.::...|||.|| |...::||:|.||:..|..|.:||:.|:..||:||.::|:::::|||..
 Frog   801 HDEKWVFRQLVPNLE-GRYNWRLCLHHRDFEPGKAIVDNIVDSIYSSRKTICIISRHYLESEWCS 864

  Fly   933 LEFRAAHRSALNEGRSRIIVIIYSDIGDVEKLD--EELKAYLKMNTYLKW-----GDPWFWDKLR 990
            .|.:.|......|....:|::....|.| ..|.  .:::..:|..|||.|     ....||.::.
 Frog   865 KEIQLASFRLFEEHTDVLILLFLEQIPD-HHLSPYHQIRKVIKKKTYLIWPQERNATSIFWYRVS 928

  Fly   991 FAL 993
            .||
 Frog   929 QAL 931

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 19/60 (32%)
leucine-rich repeat 176..198 CDD:275380 7/23 (30%)
leucine-rich repeat 199..222 CDD:275380 7/23 (30%)
LRR_RI 216..542 CDD:238064 104/493 (21%)
LRR_8 221..281 CDD:290566 20/60 (33%)
leucine-rich repeat 223..270 CDD:275380 15/47 (32%)
leucine-rich repeat 271..294 CDD:275380 6/49 (12%)
leucine-rich repeat 295..320 CDD:275380 6/101 (6%)
leucine-rich repeat 321..343 CDD:275380 9/47 (19%)
LRR_8 342..402 CDD:290566 22/81 (27%)
leucine-rich repeat 344..367 CDD:275380 7/44 (16%)
leucine-rich repeat 368..391 CDD:275380 8/23 (35%)
LRR_8 390..450 CDD:290566 22/60 (37%)
leucine-rich repeat 392..415 CDD:275380 10/23 (43%)
leucine-rich repeat 416..439 CDD:275380 6/23 (26%)
leucine-rich repeat 440..474 CDD:275380 8/34 (24%)
leucine-rich repeat 475..498 CDD:275380 7/23 (30%)
LRR_8 477..534 CDD:290566 21/68 (31%)
leucine-rich repeat 499..520 CDD:275380 10/24 (42%)
leucine-rich repeat 523..552 CDD:275380 7/41 (17%)
LRRCT 561..619 CDD:214507 5/58 (9%)
LRRNT 631..667 CDD:214470 6/36 (17%)
leucine-rich repeat 664..693 CDD:275380 0/29 (0%)
LRR_8 669..726 CDD:290566 10/57 (18%)
leucine-rich repeat 694..715 CDD:275380 5/21 (24%)
leucine-rich repeat 716..737 CDD:275380 6/21 (29%)
LRRCT 751..800 CDD:214507 12/52 (23%)
TIR 858..996 CDD:214587 48/144 (33%)
LOC100485706XP_002942581.1 leucine-rich repeat 43..60 CDD:275380 7/18 (39%)
LRR_8 <64..96 CDD:290566 10/37 (27%)
leucine-rich repeat 64..85 CDD:275380 8/26 (31%)
LRR_RI <79..167 CDD:238064 29/88 (33%)
LRR_8 86..144 CDD:290566 17/58 (29%)
leucine-rich repeat 86..109 CDD:275380 7/23 (30%)
leucine-rich repeat 110..133 CDD:275380 9/23 (39%)
LRR_8 133..193 CDD:290566 13/60 (22%)
leucine-rich repeat 134..157 CDD:275380 6/23 (26%)
leucine-rich repeat 158..233 CDD:275380 11/75 (15%)
leucine-rich repeat 183..195 CDD:275378 0/12 (0%)
LRR_RI 253..460 CDD:238064 41/208 (20%)
leucine-rich repeat 256..282 CDD:275378 0/26 (0%)
leucine-rich repeat 283..309 CDD:275380 1/26 (4%)
leucine-rich repeat 310..333 CDD:275380 3/23 (13%)
LRR_8 332..391 CDD:290566 12/59 (20%)
leucine-rich repeat 334..357 CDD:275380 6/23 (26%)
leucine-rich repeat 358..380 CDD:275380 6/22 (27%)
LRR_RI 381..687 CDD:238064 94/431 (22%)
leucine-rich repeat 381..402 CDD:275380 1/21 (5%)
leucine-rich repeat 403..425 CDD:275380 8/23 (35%)
leucine-rich repeat 426..449 CDD:275380 10/23 (43%)
LRR_8 448..508 CDD:290566 18/71 (25%)
leucine-rich repeat 450..473 CDD:275380 6/23 (26%)
leucine-rich repeat 474..497 CDD:275380 8/34 (24%)
leucine-rich repeat 498..523 CDD:275380 8/27 (30%)
leucine-rich repeat 553..579 CDD:275380 3/26 (12%)
leucine-rich repeat 580..603 CDD:275380 10/61 (16%)
LRR_8 602..686 CDD:290566 28/157 (18%)
leucine-rich repeat 604..627 CDD:275380 10/58 (17%)
leucine-rich repeat 628..651 CDD:275380 9/57 (16%)
leucine-rich repeat 652..675 CDD:275380 3/27 (11%)
TPKR_C2 684..>722 CDD:301599 7/39 (18%)
TIR 791..927 CDD:214587 46/138 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.