DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and LOC100485201

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:XP_004920451.1 Gene:LOC100485201 XenbaseID:XB-GENE-5909728 Length:835 Species:Xenopus tropicalis

Alignment Length:897 Identity:197/898 (22%)
Similarity:333/898 (37%) Gaps:264/898 (29%)


  Fly   220 MPK-----LKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSAN 279
            :||     |.:|:|..|:|.::...||...|.:..:::..|.|..:....||....:|::.|..|
 Frog    47 VPKDLPTTLVELDLSYNRLSHIQFDDFASFTHLRALNLSYNNISAIETGSFASNVLLTNLTLFNN 111

  Fly   280 LFRSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRLRAELQS--LPGDLFEHST 342
            ....:|..||:..:.|..:.:.||....|||.:. |:....|:.|.:...|.|  |.||.    .
 Frog   112 SLTEMPSALFEPLRFLQFLDISNNFYNCATLGAE-FSMLENLRNLSIGGPLVSKVLKGDF----A 171

  Fly   343 QITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLEDN------L 401
            .|.||||....|||: ::|..::....| ||:...|             ..|:.|:.|      :
 Frog   172 PIKNISLQRFSLKTM-SSLWLYEKGAFS-DLNTQSL-------------WLDIALDTNPQALPRM 221

  Fly   402 LTGISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQIN 466
            |..::|..||:|           |.|.:....:.:           :.:|:...|.||.::    
 Frog   222 LKDLAGKAFSSL-----------RFRNLFEFTYYT-----------DAMDVFFGLADIFIK---- 260

  Fly   467 SPFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDLAF---LSQNRLHVN 528
                             .:.|....:...:|:|...::..:||..|....:.|   ||.||..:.
 Frog   261 -----------------ELTFYRGKFNENLLRLTLKNVEKSNIQDLFLLSIDFARSLSTNRTDIR 308

  Fly   529 MTHNKIRRIAL-----PEDVHLGEGYN--NNLVHVDL---NDNPLVCDCTILWFIQLVRGVHKPQ 583
            :....:||:.:     |:.:.....:.  |.:.|:|:   |.|.:.||.   | .|:|.      
 Frog   309 INDLALRRLVIKDVTNPDILRFDWTFTWFNKVSHLDIINVNFNFVPCDA---W-SQMVN------ 363

  Fly   584 YSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVI 648
             ..:..:..:||:.|  |:           ..|:|  .:|:                        
 Frog   364 -VERLDISNNRLLAS--NL-----------YNLLC--QYSE------------------------ 388

  Fly   649 NCHSGNLTHVPRLPNLH------KNM--------------QLMELHLENNTLLRLPSAN--TPGY 691
                        |||||      .||              :|..|.|.:|.|..|....  ||  
 Frog   389 ------------LPNLHTFIASDNNMRSLYTLSLLTLTWPKLATLDLTSNYLGALDEVCTWTP-- 439

  Fly   692 ESVTSLHLAGNNLTSIDVDQLPTNLTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLSGN----- 751
             .:|.|.|..|.|.......||..:.|||:|.:.|:.|:   :.:.||..|.:.:.||.|     
 Frog   440 -QITKLILKDNTLKVGVFKCLPVTVEHLDMSNSLLERLD---MDYFNRATKLKVLILSQNKLKFI 500

  Fly   752 --PWMC-------------------------------------DCTAKPLLLFTQDNFER---IG 774
              .|.|                                     .||......||:...||   :.
 Frog   501 SRDWKCPNLQVLGLEGNSFSVIDKGSFKDLPELRRLTAGDNPYHCTCDLYAFFTETLTERRVSLA 565

  Fly   775 DRNEMMCVNAEMPTRMVELSTNDICP--AEKGVFIALAVVIALTGLLAGFTAALYYKFQTEIKIW 837
            |..|.  .|...|..:::.......|  .|..|.:.:|:.::.|.::......|.::|...    
 Frog   566 DWPEE--YNCYHPPHLLDTKVEFYNPGRVECDVRLVVAISVSTTAVVVMLCMLLCWRFDVP---- 624

  Fly   838 LYAHNLLLWFV--------------TEEDLDKDKKFDAFISYSHKDQSFIEDYLVPQLEHGPQKF 888
                    |::              :..| .:|..:.|||||||.|..::...|:.:||.....:
 Frog   625 --------WYLRTTCSIVQSKYRSRSFHD-SRDYNYHAFISYSHSDADWVRGELLYRLESCSPPY 680

  Fly   889 QLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVI 953
            ::|:||||:|.|..|.:||:.::..||:.|.|||:||:.|||...|...||:.|:......:|::
 Frog   681 RVCIHERDFLPGRWIIDNIIENIESSRKIIFVLSRNFVNSEWCNYELYFAHQRAIGHAFEDVILV 745

  Fly   954 IYSDI--GDVEKLDEELKAYLKMNTYLKWGDP-----WFWDKLRFALPHRRP 998
            :...:  .|:.|..::|:..::..|||:|...     :||.:|:..|....|
 Frog   746 VKEKVTMEDLPKRFQKLRKMMRTKTYLEWPSEQNRQHFFWIQLKSILGKANP 797

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 6/18 (33%)
leucine-rich repeat 176..198 CDD:275380
leucine-rich repeat 199..222 CDD:275380 1/2 (50%)
LRR_RI 216..542 CDD:238064 75/343 (22%)
LRR_8 221..281 CDD:290566 17/65 (26%)
leucine-rich repeat 223..270 CDD:275380 12/47 (26%)
leucine-rich repeat 271..294 CDD:275380 6/23 (26%)
leucine-rich repeat 295..320 CDD:275380 7/25 (28%)
leucine-rich repeat 321..343 CDD:275380 7/24 (29%)
LRR_8 342..402 CDD:290566 16/66 (24%)
leucine-rich repeat 344..367 CDD:275380 9/23 (39%)
leucine-rich repeat 368..391 CDD:275380 4/23 (17%)
LRR_8 390..450 CDD:290566 10/66 (15%)
leucine-rich repeat 392..415 CDD:275380 8/29 (28%)
leucine-rich repeat 416..439 CDD:275380 2/23 (9%)
leucine-rich repeat 440..474 CDD:275380 4/34 (12%)
leucine-rich repeat 475..498 CDD:275380 2/23 (9%)
LRR_8 477..534 CDD:290566 11/60 (18%)
leucine-rich repeat 499..520 CDD:275380 5/24 (21%)
leucine-rich repeat 523..552 CDD:275380 6/36 (17%)
LRRCT 561..619 CDD:214507 12/58 (21%)
LRRNT 631..667 CDD:214470 5/42 (12%)
leucine-rich repeat 664..693 CDD:275380 12/51 (24%)
LRR_8 669..726 CDD:290566 19/59 (32%)
leucine-rich repeat 694..715 CDD:275380 7/21 (33%)
leucine-rich repeat 716..737 CDD:275380 6/21 (29%)
LRRCT 751..800 CDD:214507 13/96 (14%)
TIR 858..996 CDD:214587 48/145 (33%)
LOC100485201XP_004920451.1 LRR_RI <40..>144 CDD:238064 26/97 (27%)
LRR_8 53..113 CDD:290566 15/60 (25%)
leucine-rich repeat 55..78 CDD:275378 8/23 (35%)
leucine-rich repeat 79..102 CDD:275378 4/23 (17%)
leucine-rich repeat 103..126 CDD:275378 6/23 (26%)
leucine-rich repeat 127..151 CDD:275378 7/25 (28%)
leucine-rich repeat 364..391 CDD:275380 9/78 (12%)
leucine-rich repeat 392..417 CDD:275380 4/25 (16%)
leucine-rich repeat 418..440 CDD:275380 8/25 (32%)
leucine-rich repeat 441..462 CDD:275378 7/21 (33%)
leucine-rich repeat 463..486 CDD:275378 8/26 (31%)
LRR_8 485..542 CDD:290566 6/57 (11%)
LRR_4 485..523 CDD:289563 6/38 (16%)
leucine-rich repeat 487..508 CDD:275378 5/21 (24%)
leucine-rich repeat 509..532 CDD:275378 0/23 (0%)
leucine-rich repeat 533..545 CDD:275378 0/12 (0%)
TIR 651..788 CDD:214587 46/137 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.