DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and tlr7

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001120883.1 Gene:tlr7 XenbaseID:XB-GENE-486605 Length:1054 Species:Xenopus tropicalis

Alignment Length:1120 Identity:241/1121 (21%)
Similarity:415/1121 (37%) Gaps:342/1121 (31%)


  Fly    37 MSIDGLCQCAPI-MSEYEIICPANAENPTFRLTIQPKDYVQIMCNL----TDTTDYQQLPKKLRI 96
            :.:|..|.|.|. :...:.:|       |.||.::.:.:..:. ||    .|.....:.||.   
 Frog    98 VELDFRCNCVPAKVGPKDHVC-------TKRLDVEDRSFASLY-NLRSLYLDGNQLIEFPKG--- 151

  Fly    97 GEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRR 161
                        ||.:..:.|:              |.:|: ::|:|.:|..|..::        
 Frog   152 ------------LPPNLQLLSL--------------EINNI-ISISRNNLSELSNIQ-------- 181

  Fly   162 LTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQL 226
                   :|...:|..|....::..::....|.||:||..:...||.|..:|.|:   ...||:|
 Frog   182 -------MLYLGQNCYHRNPCSDSFKIEKDAFKDLKNLSILSMKSNNLSFVPGGL---SDSLKEL 236

  Fly   227 NLWSNQLHNLTKHDFEGATSVLGIDIH-----------------DNGIEQLPHDVFAHLTNVTDI 274
            .|::|.:..:.:||.|...::..:|:.                 :|...|:....|:.|.|:..:
 Frog   237 YLYNNAIQYIEEHDLENLINLEILDLSGNCPRCYNSPFPCTPCPNNAPIQIHPKAFSSLKNLQVL 301

  Fly   275 NLSANLFRSLPQGLFDHNKHLNEVRLMNN-------------RVP------------LATLPSRL 314
            .|.:|..||:|:..|.:|::|..:.|..|             .:|            |...||.|
 Frog   302 RLHSNSLRSIPEQWFKNNRNLQVLDLSENFLASEISTANFLKYIPSLKSLDLSFNFELQVYPSDL 366

  Fly   315 -----FANQPELQILRLRAELQSLPGDLFE-----------HSTQITNISLGDNLLKTLPATLLE 363
                 |::...|:.||:|       |.:|:           |...:|.:.|..|.:|....:|..
 Frog   367 KLSSIFSSLASLETLRIR-------GYVFQNLKKNNLMPLVHLPNLTLLDLSTNFIKVADFSLFP 424

  Fly   364 HQVNLLSLDLSNNRLTHLPDS--------------------------LFAHTTNLTDLRLEDNLL 402
            ...:|.::.||||:::  |.|                          .|.:..|....:.:|.  
 Frog   425 KFKSLQTIILSNNKIS--PSSEANIDSCSASQVSSGHYIGRTFQEVHYFEYDENARKCKAKDK-- 485

  Fly   403 TGISGDIFSN-----LGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQ 462
            ...:..:|.|     .|.  :|.:|:|.:..:.:..|.:.:.|:.|:|..|.|.          |
 Frog   486 ENFTFKLFLNESCQAYGQ--SLDLSQNNIFFVKATDFTNLSFLKCLNLSGNAIS----------Q 538

  Fly   463 TQINSPFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLHV 527
            |...|.|..::.|..|:..||.|..:|:.....:.:|..||:|.|        |..||::...||
 Frog   539 TLNGSEFRNLNRLKYLDFSNNRIDLLYSTAFQELTELEVLDISNN--------DHYFLAEGITHV 595

  Fly   528 -NMTHN--KIRRIALPEDVHLGEGYNNNLVHVDLNDNPLVCD-----------CTILW------F 572
             |.|.|  |:.::.:          |||.:....|.: ||..           ..|||      :
 Frog   596 FNFTKNLEKLTKLMM----------NNNQISTSTNRH-LVSQSLRILEFKGNYLNILWKDGDTRY 649

  Fly   573 IQLVRGVHKPQYSRQFKL--RTDRLVCSQPNVLEGTPVRQIEPQTLICPL------DFSDDPRER 629
            :...:.::|     .:||  ..:.|....|.|.||.|     |..|...|      .||.|    
 Frog   650 LNFFKNLNK-----LYKLDISENSLTFVPPGVFEGMP-----PDLLELYLARNKLKTFSWD---- 700

  Fly   630 KCPRGCNCHVRTYDKALVINCHSGNLTHVPR-LPNLHKNMQLMELHLENNTLLRLPSANTPGYES 693
                    .:...:|..|::..:..||.||| |.|...:::  :|.|.||.:.:|......|..|
 Frog   701 --------KLHLLEKLSVLDLSNNYLTTVPRELSNCTSSIK--KLILSNNKIKKLTPFFLRGSVS 755

  Fly   694 VTSLHLAGNNLTSIDVDQLP----TNLTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLSGNPWM 754
            :..|.|:.|.:.:|.....|    .|||.|                           .|.|||:.
 Frog   756 LKYLDLSDNLIQNIGHSSFPEDVLDNLTEL---------------------------LLQGNPFK 793

  Fly   755 CDCTAKPLLLFTQDNFERIGDRNEMMCVNAEMPTR-------MVELST------NDICPAEKGVF 806
            |:|..  :.|.:..|..::...|.:..|....|..       :::|.|      |.|..|....|
 Frog   794 CNCNL--VWLVSWINQTKVYIPNLVTGVTCSGPGAHRGQSLVLLDLYTCEQYHLNLILQALSASF 856

  Fly   807 IALAVVIALTGLLAGFTAALYYKFQTEIKIWLYAHNLLLWFVTEEDLDKDKKF-----DAFISYS 866
            |...:|::::..|      .|:.|      |...|      :.:..:...|:|     ||.|.|.
 Frog   857 IICLMVVSVSSHL------FYWDF------WFIYH------LFKAKIHGYKRFPKCCYDALIMYD 903

  Fly   867 HKDQSFIEDYLVPQL-----EHGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFI 926
            .|| |.:.|::...|     :.|.:...||:.|||:|.|....:|:..|:..||:|:.||::.::
 Frog   904 TKD-SAVSDWVFNDLVNILEKQGNKMLNLCLEERDFLAGQPFLDNLSESIQISRKTVFVLTRKYV 967

  Fly   927 KSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGDVEKLDEELK--AYLKM------NTYLKW--- 980
            |....:..|..||:..:.|....||:|:         |::.|:  .||::      |:.|.|   
 Frog   968 KKGHFKTAFYMAHQRLIEEKVDVIILIL---------LEKTLQRSRYLRLRKRLCANSVLYWPSN 1023

  Fly   981 --GDPWFWDKLRFAL 993
              ...:||..|:.|:
 Frog  1024 PNSQSYFWHCLKSAI 1038

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 17/59 (29%)
leucine-rich repeat 176..198 CDD:275380 4/22 (18%)
leucine-rich repeat 199..222 CDD:275380 6/23 (26%)
LRR_RI 216..542 CDD:238064 88/418 (21%)
LRR_8 221..281 CDD:290566 16/77 (21%)
leucine-rich repeat 223..270 CDD:275380 13/64 (20%)
leucine-rich repeat 271..294 CDD:275380 7/23 (30%)
leucine-rich repeat 295..320 CDD:275380 9/55 (16%)
leucine-rich repeat 321..343 CDD:275380 7/33 (21%)
LRR_8 342..402 CDD:290566 15/86 (17%)
leucine-rich repeat 344..367 CDD:275380 5/23 (22%)
leucine-rich repeat 368..391 CDD:275380 8/49 (16%)
LRR_8 390..450 CDD:290566 13/65 (20%)
leucine-rich repeat 392..415 CDD:275380 4/28 (14%)
leucine-rich repeat 416..439 CDD:275380 4/23 (17%)
leucine-rich repeat 440..474 CDD:275380 9/34 (26%)
leucine-rich repeat 475..498 CDD:275380 6/23 (26%)
LRR_8 477..534 CDD:290566 19/60 (32%)
leucine-rich repeat 499..520 CDD:275380 7/21 (33%)
leucine-rich repeat 523..552 CDD:275380 8/32 (25%)
LRRCT 561..619 CDD:214507 16/77 (21%)
LRRNT 631..667 CDD:214470 9/37 (24%)
leucine-rich repeat 664..693 CDD:275380 6/29 (21%)
LRR_8 669..726 CDD:290566 16/61 (26%)
leucine-rich repeat 694..715 CDD:275380 5/25 (20%)
leucine-rich repeat 716..737 CDD:275380 3/21 (14%)
LRRCT 751..800 CDD:214507 13/62 (21%)
TIR 858..996 CDD:214587 44/160 (28%)
tlr7NP_001120883.1 leucine-rich repeat 54..75 CDD:275380
LRR_8 71..145 CDD:290566 11/55 (20%)
leucine-rich repeat 76..96 CDD:275380
leucine-rich repeat 97..134 CDD:275380 8/44 (18%)
leucine-rich repeat 135..155 CDD:275380 6/35 (17%)
LRR_8 154..222 CDD:290566 17/98 (17%)
leucine-rich repeat 156..179 CDD:275380 7/38 (18%)
leucine-rich repeat 180..211 CDD:275380 6/46 (13%)
LRR_8 210..265 CDD:290566 16/58 (28%)
leucine-rich repeat 212..256 CDD:275380 14/47 (30%)
leucine-rich repeat 213..232 CDD:275380 5/22 (23%)
LRR_RI <232..356 CDD:238064 25/124 (20%)
leucine-rich repeat 257..297 CDD:275380 5/40 (13%)
LRR_RI 296..>440 CDD:238064 34/151 (23%)
LRR_8 296..356 CDD:290566 12/60 (20%)
leucine-rich repeat 298..321 CDD:275380 7/23 (30%)
leucine-rich repeat 348..377 CDD:275380 5/29 (17%)
leucine-rich repeat 405..428 CDD:275380 5/23 (22%)
LRR_RI <503..702 CDD:238064 57/252 (23%)
LRR_8 503..561 CDD:290566 17/70 (24%)
leucine-rich repeat 503..525 CDD:275380 4/24 (17%)
leucine-rich repeat 526..550 CDD:275380 9/34 (26%)
leucine-rich repeat 551..574 CDD:275380 6/23 (26%)
leucine-rich repeat 575..604 CDD:275380 13/37 (35%)
leucine-rich repeat 605..658 CDD:275380 9/64 (14%)
leucine-rich repeat 628..650 CDD:275380 3/22 (14%)
LRR_RI <650..>791 CDD:238064 43/192 (22%)
leucine-rich repeat 659..683 CDD:275380 9/29 (31%)
leucine-rich repeat 684..707 CDD:275380 5/35 (14%)
LRR_8 707..766 CDD:290566 19/61 (31%)
leucine-rich repeat 708..731 CDD:275380 8/23 (35%)
leucine-rich repeat 732..755 CDD:275380 6/25 (24%)
leucine-rich repeat 756..774 CDD:275380 4/18 (22%)
LRRCT 790..836 CDD:214507 9/48 (19%)
TIR_2 895..>998 CDD:304906 33/113 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.