DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tl and tlr20.4

Sequence 1:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:XP_009303038.2 Gene:tlr20.4 ZFINID:ZDB-GENE-071002-1 Length:951 Species:Danio rerio

Alignment Length:1030 Identity:233/1031 (23%)
Similarity:391/1031 (38%) Gaps:318/1031 (31%)


  Fly   152 LKRFRFTTRRLTHIPANLL-TDMRNLSHLELRANIEEMPSHLFDDLENLESI----EFGSNKLRQ 211
            :|.|..|    |:.|.|:. .|.::::  :::.::..:||       :|:|:    :.||:.:  
Zfish    38 VKEFPLT----TYCPGNINGADCKHVT--DIKEDLRGLPS-------SLQSVCIQMDGGSDGV-- 87

  Fly   212 MPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINL 276
            :....|.....||||.:             .|..|            |:|.:.|..|||||.:::
Zfish    88 LAPNSFSSFASLKQLTI-------------AGCFS------------QIPPEAFNGLTNVTSLSI 127

  Fly   277 SANL----------FRSLPQ----------------GLFDHNKHLNEVRL----MNNRVPLATLP 311
            |::.          |..||.                .:||...||.|:.|    :||   ::.:.
Zfish   128 SSSNSEKCCEVALDFSRLPSLTRLFISYYDLSLFKLNVFDKIPHLEELHLGNVCLNN---ISEVL 189

  Fly   312 SRLFANQPELQILRLRAELQSLPGDLFEHST----QITNISLGDNLLK-TLPATLLEH------- 364
            .|| ||...|:...|...|..|     :||.    ..:|||...|:.| .|..|.:||       
Zfish   190 CRL-ANVKSLKQFNLDGVLHKL-----QHSNCSVFNTSNISTEFNIEKVNLTLTKVEHVDEGALK 248

  Fly   365 -------------------------------------------------------------QVNL 368
                                                                         .:||
Zfish   249 TFGKLFFFQFFVSHTDFLRDLSLIGVHKIRTLDFKVDVLNVDDLCVAAKLYSVERMFVSYEMINL 313

  Fly   369 --------------LSLDLSNN---RLTHLPD--SLFAHTTNLTDLRLEDNLLTGISGDIFS--- 411
                          :|:.|||:   ::..|.|  |||...:|||.:.::.::|.  |.|..|   
Zfish   314 SVTPTNMSDGCEYIMSIALSNDISVKIVDLLDVYSLFQIFSNLTTVTIQYHILR--SNDFLSLCA 376

  Fly   412 ----NLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQINSPFGY- 471
                .:..|..:::..||:..|.|..|:....|:.|.|             :|.:..:...|.: 
Zfish   377 SFPQAVKQLSVMILKNNRIDKIVSHQFMCFVNLKTLKL-------------VMSKISVFEDFAFI 428

  Fly   472 -MHGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYN--------------NISSLGYEDLAF-- 519
             ::.|..|||.:|.|..::....:.:.:||.|||..|              |:|||...||.|  
Zfish   429 GLNKLKELNLHSNKISSIHRHTFSGLHELRVLDLQENPIIYIEPKSFGHFTNLSSLLLGDLNFPP 493

  Fly   520 -LSQNRLHV---------NMTHNKIRRIALPEDVHLGEGYNNNL-----VHVDLNDNPLVCDCTI 569
             :|..:||:         |:::..|.....|  :||..|.|..|     :|:. ....:|.||..
Zfish   494 NMSLIKLHLSDIFGGIPSNLSNVFISSGLRP--MHLVIGSNTTLNNGLNLHIK-GQYVIVEDCNS 555

  Fly   570 LWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTP-VRQIEPQTLICPLDFSDDPRERKCPR 633
            |....:|          ..:::...::|....:.:..| |..:|.|::     |:|:..:.....
Zfish   556 LLLTSVV----------TLQIQAAYMICENEFIGKYVPSVVSLEFQSM-----FADNIGDLSVIN 605

  Fly   634 GCNCHVRTYDKALVINCHSGNLTHVPRLPNLHKNM-QLMELHLENNTLLRLPSANTPGYESVTSL 697
            .. .|::|      :...:.:||:.|....:..|: :|.::.|.|..:..|..:.|...:::|||
Zfish   606 QL-VHLKT------LKLENIDLTNQPNTGIMFHNLTKLEKMILMNCKIFFLDKSVTKDLKALTSL 663

  Fly   698 HLAGNNLTSI--DVDQLPTNLTHLDISWNHLQML-------NATVLGFLNRTMKWRSVKLSGNPW 753
            .|......:|  :..:.||:|.:|     |.|.|       |..::.::....|...|  ..||.
Zfish   664 VLIPKEAVNIIQNFMEQPTHLKYL-----HFQCLDLYCSCDNTWLVSWIRDNGKVEVV--MSNPS 721

  Fly   754 MCDCTAKPLLLFTQDNFER---IGDRNEMMCVNAEMPTRMVELSTNDICPAEKGVFIALAVVIAL 815
            |.|     |...|.|..:.   |....|    |..:....|..|.:       .||:.:.:|:.|
Zfish   722 MED-----LRCLTDDEVDHLNFISYAKE----NCSIDLDFVFFSCS-------SVFLCIFIVVVL 770

  Fly   816 TGLLAGFTAALYYKFQTEIKIWLYAHNLLLWFVTEEDLD-KDK---KFDAFISYSHKDQSFIEDY 876
            .....|    .|:|        .:.|....||  .|.|. |:|   ::|||:|||.||:.::.:.
Zfish   771 MYKFVG----QYFK--------PFYHIASGWF--REALRMKEKQQYRYDAFVSYSGKDEHWVIEE 821

  Fly   877 LVPQLE-HGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHR 940
            |:|.|| .||...:||:|.||:.:|..|.|||..|:..||||:.::|:|::.|.|..:|.:.|..
Zfish   822 LLPNLEQRGPPFLRLCLHSRDFQLGHDIVENITDSIYASRRTLCLVSRNYLNSNWCSVEMQLATY 886

  Fly   941 SALNEGRSRIIVIIYSDI-GDVEKLDEELKAYLKMNTYLKW-GDP----WFWDKL 989
            ....|.|..:|::....| ..:......|...:|..|||.| .:|    .|||:|
Zfish   887 RLQVEHRDILILVFLETIPSRLLSSHHRLARLVKTRTYLDWPQEPEMHEAFWDRL 941

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 11/63 (17%)
leucine-rich repeat 176..198 CDD:275380 2/22 (9%)
leucine-rich repeat 199..222 CDD:275380 5/27 (19%)
LRR_RI 216..542 CDD:238064 100/483 (21%)
LRR_8 221..281 CDD:290566 15/70 (21%)
leucine-rich repeat 223..270 CDD:275380 11/47 (23%)
leucine-rich repeat 271..294 CDD:275380 8/49 (16%)
leucine-rich repeat 295..320 CDD:275380 9/29 (31%)
leucine-rich repeat 321..343 CDD:275380 6/26 (23%)
LRR_8 342..402 CDD:290566 23/152 (15%)
leucine-rich repeat 344..367 CDD:275380 9/92 (10%)
leucine-rich repeat 368..391 CDD:275380 10/42 (24%)
LRR_8 390..450 CDD:290566 16/67 (24%)
leucine-rich repeat 392..415 CDD:275380 6/30 (20%)
leucine-rich repeat 416..439 CDD:275380 6/23 (26%)
leucine-rich repeat 440..474 CDD:275380 5/36 (14%)
leucine-rich repeat 475..498 CDD:275380 6/23 (26%)
LRR_8 477..534 CDD:290566 22/83 (27%)
leucine-rich repeat 499..520 CDD:275380 13/38 (34%)
leucine-rich repeat 523..552 CDD:275380 9/38 (24%)
LRRCT 561..619 CDD:214507 10/59 (17%)
LRRNT 631..667 CDD:214470 5/36 (14%)
leucine-rich repeat 664..693 CDD:275380 6/30 (20%)
LRR_8 669..726 CDD:290566 15/59 (25%)
leucine-rich repeat 694..715 CDD:275380 7/23 (30%)
leucine-rich repeat 716..737 CDD:275380 6/28 (21%)
LRRCT 751..800 CDD:214507 12/52 (23%)
TIR 858..996 CDD:214587 50/140 (36%)
tlr20.4XP_009303038.2 leucine-rich repeat 99..121 CDD:275380 11/47 (23%)
leucine-rich repeat 148..171 CDD:275380 2/23 (9%)
leucine-rich repeat 172..197 CDD:275380 9/29 (31%)
leucine-rich repeat 229..265 CDD:275380 5/36 (14%)
leucine-rich repeat 385..408 CDD:275378 6/23 (26%)
LRR_8 408..467 CDD:316378 17/72 (24%)
leucine-rich repeat 409..432 CDD:275378 5/36 (14%)
PLN00113 <427..>516 CDD:331614 23/89 (26%)
leucine-rich repeat 433..456 CDD:275378 6/23 (26%)
leucine-rich repeat 457..480 CDD:275378 6/23 (26%)
leucine-rich repeat 541..584 CDD:275380 8/54 (15%)
leucine-rich repeat 585..609 CDD:275380 5/30 (17%)
leucine-rich repeat 610..635 CDD:275380 5/31 (16%)
leucine-rich repeat 636..659 CDD:275380 5/23 (22%)
TIR 803..941 CDD:214587 49/138 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.