DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlO and TwdlD

DIOPT Version :8

Sequence 1:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_651492.1 Gene:TwdlD / 43210 FlyBaseID:FBgn0039444 Length:256 Species:Drosophila melanogaster

Alignment Length:260 Identity:113/261 (43%)
Similarity:154/261 (59%) Gaps:35/261 (13%)


  Fly     1 MRFLIAFCLIGAACAQ----YNY--------GAGF---TGAASDNVPS-----YSGSSVGDSYDG 45
            ||..|..||:..:|:.    |||        |..|   :|.....:||     .||.:|......
  Fly     1 MRAFIVLCLLAVSCSADKLGYNYQPVAHADEGLSFLPGSGQVIGELPSQVLPVQSGEAVLSQPIE 65

  Fly    46 AASSPDYS-VSSELNKEYYTFEADESQFEDPLAAQKIAGSVNKGLRVVFIKGPENRGLENAALAL 109
            |..:|..: :..|..||:|::.|.|.|:::..:.|:||.|:.|.||||||:.|||:|.|.|||.|
  Fly    66 APVAPQIAPLVEEFQKEFYSYAAPEEQYDEGASNQQIANSLKKNLRVVFIRTPENQGFERAALQL 130

  Fly   110 AKQAAEQRTAIYVLNKQTDIGDLAQKFNAARQNSNQRPEVHFVKYRTPEDAANAQRAIQSQYDNL 174
            |||:|:|.||||||.||:|:.:||::.||.:.:|..:||||||||||||||||||.|||:||:.|
  Fly   131 AKQSAQQETAIYVLTKQSDVSNLAKQLNALKTSSTNKPEVHFVKYRTPEDAANAQLAIQNQYNQL 195

  Fly   175 GGSSQSINGGVANAINFASAAPVVPARRGPNYSPPAAATSNSYLPANI----------LRRLRIR 229
            .|.|:..|.|.|..:||||:    ||:.....:..|||.|:.|||||:          |||.|::
  Fly   196 PGVSRISNEGRAPVLNFASS----PAQAAAIPAVAAAAPSSEYLPANVVAGQDYLPPNLRRFRVK 256

  Fly   230  229
              Fly   257  256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TwdlONP_651487.1 DM5 56..157 CDD:214776 56/101 (55%)
TwdlDNP_651492.1 DM5 78..178 CDD:214776 56/100 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1072366
eggNOG 1 0.900 E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR31927
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.