DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlO and TwdlN

DIOPT Version :8

Sequence 1:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_733160.1 Gene:TwdlN / 43207 FlyBaseID:FBgn0039441 Length:309 Species:Drosophila melanogaster

Alignment Length:213 Identity:136/214 (64%)
Similarity:160/214 (75%) Gaps:13/214 (6%)


  Fly    20 GAGFTGAASDNVPSYSGSSVGDSYDGAASSPDYSV---SSELNKEYYTFEADESQFEDPLAAQKI 81
            |.|.:|..|....|..||.:|.:  |.::...|:.   ::||.||::|:.|:|..|::|.|.:::
  Fly   106 GLGSSGLGSGLGSSGLGSGLGSA--GLSAPVSYNAPAPAAELQKEFFTYTANEEDFDEPQALERV 168

  Fly    82 AGSVNKGLRVVFIKGPENRGLENAALALAKQAAEQRTAIYVLNKQTDIGDLAQKFNAARQNSNQR 146
            |.|||||||||||||||||||||||||||||||:|.|||||||||.||||||||.||.|.|||.:
  Fly   169 ASSVNKGLRVVFIKGPENRGLENAALALAKQAAQQETAIYVLNKQADIGDLAQKLNAIRSNSNNK 233

  Fly   147 PEVHFVKYRTPEDAANAQRAIQSQYDNLGGSSQSINGGVANAINFASAAPVVPARRGPNYSPPAA 211
            ||||||||||||||||||||||||||.||||||:||||||||:|||||.||..|        .|.
  Fly   234 PEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQAINGGVANALNFASAGPVRQA--------TAQ 290

  Fly   212 ATSNSYLPANILRRLRIR 229
            ...|||||:::|||||.|
  Fly   291 IPENSYLPSSVLRRLRYR 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TwdlONP_651487.1 DM5 56..157 CDD:214776 76/101 (75%)
TwdlNNP_733160.1 DM5 143..244 CDD:214776 76/101 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1071928
eggNOG 1 0.900 E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR31927
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.