DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlO and TwdlG

DIOPT Version :8

Sequence 1:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster

Alignment Length:287 Identity:81/288 (28%)
Similarity:113/288 (39%) Gaps:76/288 (26%)


  Fly     1 MRFLIAFCLIGAACA---QYNYGAG---------------------------------------- 22
            |.|.|..||:|.|..   .|||.|.                                        
  Fly     1 MHFFIVPCLLGLAAGIPQGYNYQAQQQLQSSAQAGQLHLPSIPQFATLAEQTILQQALQAPKLQQ 65

  Fly    23 -FTGAASDNVPSYSGSSVGDSYDGAASSPDYSVSSELN---------------KEYYTF----EA 67
             .||  .:.:.|||..:...:|...|:  .:..:|..|               |:.|..    |.
  Fly    66 VLTG--GEGLASYSNQNQASAYQQQAT--QFGPNSAYNALPQAHQPQQQHLVSKDIYVHVPPAEE 126

  Fly    68 DESQFEDPLAAQKIAGSVNKGLRVVFIKGPENRGLENAALALAKQAAEQRTAIYVLNKQTDIGDL 132
            .|.::..|:..   .....|..|:||||.| ...:..|||.:.:...|::|.||||.|:.|..||
  Fly   127 PEDRYPQPVLP---PAPPRKHYRIVFIKAP-TTSVSKAALRIKQAPVEEKTIIYVLTKKPDPLDL 187

  Fly   133 AQKFNAARQNSNQRPEVHFVKYRTPEDAANAQRAIQSQYDNLGGSSQSINGGVANAINFASAAPV 197
            .............:|||.|:||:|.|:||:|||.||:|||.|||:||..:.|||..   .|...|
  Fly   188 QTAIEEIAPKQPSKPEVFFIKYKTQEEAAHAQRTIQAQYDQLGGTSQVSDEGVAPV---TSVIGV 249

  Fly   198 VPARRGPNYSPP--AAATSNSYLPANI 222
            :..:|....|..  :.:..|||||.|:
  Fly   250 LDNQRNNGISSGQFSGSLPNSYLPTNL 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TwdlONP_651487.1 DM5 56..157 CDD:214776 34/120 (28%)
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 32/103 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1074706
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR31927
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.