DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlO and Twdlbeta

DIOPT Version :8

Sequence 1:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_610707.2 Gene:Twdlbeta / 36265 FlyBaseID:FBgn0033658 Length:198 Species:Drosophila melanogaster

Alignment Length:227 Identity:46/228 (20%)
Similarity:77/228 (34%) Gaps:68/228 (30%)


  Fly     5 IAFCLIGAACAQYNYGA----------GFTGAASDNVPSYSGSSVGDSYDGAASSPDYSVSSELN 59
            :|.|:......:..||.          |....|:..:|.|...:   ::.|..::.:..|:..: 
  Fly    14 LAICVARPEPPRSRYGPPPPPAPQKEYGPPAPAAQPLPVYGPPA---AFYGPPAASEALVTKNV- 74

  Fly    60 KEYYTFEADESQFEDPLAAQKIAGSV-NKGLRVVFIKGPENRGLENAALALAKQAAEQRTAIYVL 123
              |.....:|.:|..  |:..|..:| .|..:::|||.|.........|....| .|.:|.:|||
  Fly    75 --YVHVPPEEPEFYP--ASSPIQTAVPKKHYKIIFIKAPNPPTPVRQVLPPPVQ-DEHKTLVYVL 134

  Fly   124 NKQTDIGDLAQK---FNAARQNSNQRPEVHFVKYRTPEDAANAQRAIQSQYDNLGGSSQSINGGV 185
            .|:.:    .|:   ..|.......:|||:|:||:            |.|               
  Fly   135 VKKPE----EQQPVILPAPEPTEPSKPEVYFIKYK------------QQQ--------------- 168

  Fly   186 ANAINFASAAPVVPARRGPNYSPPAAATSNSY 217
                          |:....|.||.:|.|..|
  Fly   169 --------------AKPATQYGPPPSAPSEEY 186

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TwdlONP_651487.1 DM5 56..157 CDD:214776 27/105 (26%)
TwdlbetaNP_610707.2 DM5 68..167 CDD:214776 29/121 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR31927
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.