DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tx and Atoh1

Sequence 1:NP_001287543.1 Gene:tx FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001102708.1 Gene:Atoh1 RGDID:1565171 Length:351 Species:Rattus norvegicus

Alignment Length:290 Identity:75/291 (26%)
Similarity:110/291 (38%) Gaps:72/291 (25%)


  Fly    22 DSKDSRKRKT------ASARGEKYSLRQKRQKRGSNEDGESANLADFQLELDPIAEPASKSRKNA 80
            ||.|.|...|      .:||..:|.|..  .:.|::|.....:.||.|.||...:.....|:...
  Rat    55 DSTDPRAWLTPTLQGLCTARAAQYLLHS--PELGASEAAAPGDEADGQGELVRRSGCGGLSKSPG 117

  Fly    81 PTK-------------------SKTKAPP------LSKYRRKTANARERTRMREINTAFETLRHC 120
            |.|                   |:.:||.      :.|.||..||||||.||..:|.||:.||:.
  Rat   118 PVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNV 182

  Fly   121 VPEAIKGEDAANTNEKLTKITTLRLAMKYITMLTDSIRDPSYESEFIGE--------CLEESANR 177
            :|       :.|.::||:|..||::|..||..|::.::.||     :||        |..:..:.
  Rat   183 IP-------SFNNDKKLSKYETLQMAQIYINALSELLQTPS-----VGEQPPPPAASCKNDHHHL 235

  Fly   178 EARVDLEANEEAEVELPVPVAKKPAKTKGSGKKSS---AASKRQSQKQAKIVPQIPPISSGESCY 239
            .|....|....|.    .....:||  .|.|.:.:   |...|.|          .|.|||....
  Rat   236 RAAASYEGGAGAS----AVAGAQPA--PGGGPRPTPPGACRTRFS----------TPASSGGYSV 284

  Fly   240 ATSSIGSPASSAYASLSSSSNSHSSSSSPG 269
            ...::..||....|..:..:....|.|.||
  Rat   285 QLDALHFPAFEDRALTAMMAQKDLSPSLPG 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 26/59 (44%)
Atoh1NP_001102708.1 HLH 155..213 CDD:238036 27/65 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19290
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.