DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and ASCL2

DIOPT Version :10

Sequence 1:NP_524516.2 Gene:tx / 43190 FlyBaseID:FBgn0288888 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_005161.1 Gene:ASCL2 / 430 HGNCID:739 Length:193 Species:Homo sapiens


Alignment Length:226 Identity:59/226 - (26%)
Similarity:83/226 - (36%) Gaps:69/226 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PASK-----SRKNAPTKSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAA 131
            |||.     ||:..|..::|.....:..||   |.|||.|::.:|..|:.||..||.       .
Human    26 PASPELLRCSRRRRPATAETGGGAAAVARR---NERERNRVKLVNLGFQALRQHVPH-------G 80

  Fly   132 NTNEKLTKITTLRLAMKYITMLTDSIRDPSYESEFIGECLEESANREARVDLEANEEAEVELPVP 196
            ..::||:|:.|||.|::||..|...:             .|..|.|.|   |.....       |
Human    81 GASKKLSKVETLRSAVEYIRALQRLL-------------AEHDAVRNA---LAGGLR-------P 122

  Fly   197 VAKKPAKTKGSGKKSSAASKRQSQKQAKIVPQIPPISSGESCYATSSIGSPASSAYASLSSSSNS 261
            .|.:|:..:|.                   |...|:::..| .|:||.|...||.    ..|..|
Human   123 QAVRPSAPRGP-------------------PGTTPVAASPS-RASSSPGRGGSSE----PGSPRS 163

  Fly   262 HSSSSSPGLELDSLVGLNGISALDSLLLDTS 292
            ..||...|.|       ..:|..:..|||.|
Human   164 AYSSDDSGCE-------GALSPAERELLDFS 187

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
txNP_524516.2 bHLH_TS_taxi_Dei 95..157 CDD:381437 23/61 (38%)