DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tx and ato

Sequence 1:NP_001287543.1 Gene:tx FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_731223.1 Gene:ato FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster

Alignment Length:154 Identity:47/155 (30%)
Similarity:72/155 (46%) Gaps:25/155 (16%)


  Fly     5 TYELHNYADLNDMARATDSKDSRKRKTASARGEKYSLRQKRQKRGSNEDGESANLADFQLELDPI 69
            |.|..|: |.::.|...||.:..:.....:.||.:          ...|| |.:|||.:.: |..
  Fly   184 TEEFQNF-DFDNSALFDDSVEDDEDLMLFSGGEDF----------DGNDG-SFDLADGENQ-DAA 235

  Fly    70 AEPASKSRKNAPTKSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTN 134
            |..:.|.|     :.|...|.:.:.||..||||||.||:.:|.||:.||..:|       ....:
  Fly   236 AGGSGKKR-----RGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLP-------CLGND 288

  Fly   135 EKLTKITTLRLAMKYITMLTDSIR 158
            .:|:|..||::|..||:.|.|.:|
  Fly   289 RQLSKHETLQMAQTYISALGDLLR 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 24/59 (41%)
atoNP_731223.1 HLH 253..312 CDD:238036 25/66 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19290
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.