DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and MSGN1

DIOPT Version :10

Sequence 1:NP_524516.2 Gene:tx / 43190 FlyBaseID:FBgn0288888 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001099039.1 Gene:MSGN1 / 343930 HGNCID:14907 Length:193 Species:Homo sapiens


Alignment Length:110 Identity:35/110 - (31%)
Similarity:50/110 - (45%) Gaps:16/110 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NLADFQLELDPIAEPASKSRKNAPTKSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVP 122
            |:..||        |........|...|.....:|..||:.|:.||:.|||.:..|..|||:.:|
Human    96 NMLAFQ--------PTHLQGGGGPKAQKGTKVRMSVQRRRKASEREKLRMRTLADALHTLRNYLP 152

  Fly   123 EAIKGEDAANTNEKLTKITTLRLAMKYITMLTDSI---RDPSYES 164
            ...     :...:.||||.||:..:|||..|||.:   |:|..:|
Human   153 PVY-----SQRGQPLTKIQTLKYTIKYIGELTDLLNRGREPRAQS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_524516.2 bHLH_TS_taxi_Dei 95..157 CDD:381437 25/61 (41%)
MSGN1NP_001099039.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..59
bHLH_TS_Msgn1 118..183 CDD:381509 26/69 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.