DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osy and abca4

DIOPT Version :10

Sequence 1:NP_001034071.1 Gene:osy / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_001011033.1 Gene:abca4 / 496442 XenbaseID:XB-GENE-1000810 Length:2359 Species:Xenopus tropicalis


Alignment Length:72 Identity:16/72 - (22%)
Similarity:30/72 - (41%) Gaps:22/72 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 EDNNITPDSRMEVRFLD--EPGLAYVMTRYRETHDMVHAILDMPTNMLGEVTVKWVEALNTGLPM 217
            ::.|||.:..:.:.:.|  |||:..:...::|                |::.:|  |.:..||..
 Frog   144 KERNITRERFLVLNYKDKFEPGILQLSQWFKE----------------GKLKIK--ETVINGLEN 190

  Fly   218 CYGGAVF 224
            .  ||.|
 Frog   191 M--GAAF 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
osyNP_001034071.1 CcmA 50..285 CDD:440746 16/72 (22%)
YadH 578..773 CDD:440604
abca4NP_001011033.1 rim_protein 1..2347 CDD:130324 16/72 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.