DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6154 and Dpep1

Sequence 1:NP_651471.2 Gene:CG6154 FlyBaseID:FBgn0039420 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_446043.1 Gene:Dpep1 RGDID:620324 Length:410 Species:Rattus norvegicus

Alignment Length:376 Identity:197/377 (52%)
Similarity:247/377 (66%) Gaps:16/377 (4%)


  Fly    53 FRMQRVRNVLKEVPLIDGHNDLPWNIRKFLKNQLKDFHFGGDLRELAPWSSSAWSHTDLRRLKEG 117
            ||.| ..|:::..|:|||||||||.:.....|||:        :..|..|:.|.:||::.:|:.|
  Rat    19 FRNQ-AENIMRTTPVIDGHNDLPWQMLTLFNNQLR--------KSEANLSALAETHTNIPKLRAG 74

  Fly   118 MVSAQFWSAYAPCSSQHLDAVQLTLEQIDLIRRLVQLYPHHMALVTTASGIEQTHRTGKIASLIG 182
            .|..||||||.||.:|:.|||:..|||||:|.|:.||||.....||.:|.|.|..|.||:|||||
  Rat    75 FVGGQFWSAYMPCDTQNKDAVKRILEQIDVIHRMCQLYPETFECVTNSSDILQAFRRGKVASLIG 139

  Fly   183 VEGGHAIGTSLSVLRMFYQLGARYLTLTHTCNTPWADCCKVDEPGKYPHIGGLSQFGKLVVKEMN 247
            |||||.|.:||.|||..|.||.|||||||.|||||||...||:........|||.|||||:.|||
  Rat   140 VEGGHLIDSSLGVLRTLYHLGMRYLTLTHNCNTPWADNWLVDKGDDEAESQGLSPFGKLVLNEMN 204

  Fly   248 RLGMIVDLSHVSVPTMLDALAASRAPLIFSHSSAHAICNSSRNVPDHVLQRIAINGGLVMVAFYP 312
            |||:::|||||||.||.|||..|:||:|||||||:::|...|||||.|||.:.....||||.||.
  Rat   205 RLGVMIDLSHVSVATMKDALQLSKAPVIFSHSSAYSVCPHRRNVPDDVLQLVKSTNSLVMVNFYN 269

  Fly   313 HFVSCSGQATLHDVVAHINHIREVAGIDHVGIGAGYDGVNLVPKGLEDVSKYPHLFAALLESDKW 377
            .|||||..|||..|..|::||::|||...||:|..||||..:|.|||||||||.|.|.||..: |
  Rat   270 QFVSCSDSATLSQVADHLDHIKKVAGAGAVGLGGDYDGVTNLPVGLEDVSKYPDLIAELLRRN-W 333

  Fly   378 SEEDIAKLAGRNLIRVFKEVEAVRDQMELLRVAPIDQSIPAEDIMGRSYCR 428
            :|.::..|...||:|||..||.|.:.|::    |.:::||.|.:.|.  ||
  Rat   334 TETEVRGLLAENLLRVFSAVELVSNIMQV----PEEETIPVEKLDGS--CR 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6154NP_651471.2 Peptidase_M19 61..396 CDD:279569 182/335 (54%)
Dpep1NP_446043.1 Peptidase_M19 26..352 CDD:279569 182/335 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106007643
eggNOG 1 0.900 E1_COG2355
Hieranoid 1 1.000
Homologene 1 1.000 H80192
Inparanoid 1 1.050 367 1.000 Inparanoid score I2061
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1272387at2759
OrthoFinder 1 1.000 FOG0000983
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128396
Panther 1 1.100 O PTHR10443
Phylome 1 0.910 0.865 Consistency score
TreeFam 1 0.960
1110.760

Return to query results.
Submit another query.