DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6154 and dpep1

Sequence 1:NP_651471.2 Gene:CG6154 FlyBaseID:FBgn0039420 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001307047.1 Gene:dpep1 ZFINID:ZDB-GENE-061013-388 Length:414 Species:Danio rerio

Alignment Length:384 Identity:187/385 (49%)
Similarity:241/385 (63%) Gaps:18/385 (5%)


  Fly    45 SKTADDFDFRMQRVRNVLKEVPLIDGHNDLPWNIRKFLKNQLKDFHFGGDLRELAPWSSSAWSHT 109
            |..||:.   |.|...::.|.|||||||||||.:|....|||.|.    ||..|..      :||
Zfish    18 SSEADEL---MDRALKLMDETPLIDGHNDLPWQMRDLFNNQLNDV----DLHRLNS------THT 69

  Fly   110 DLRRLKEGMVSAQFWSAYAPCSSQHLDAVQLTLEQIDLIRRLVQLYPHHMALVTTASGIEQTHRT 174
            ::.:::.|.:|||||:|:.||.:|:.|||:.||||||:|.|:...||.......::..|......
Zfish    70 NIEKIQHGRLSAQFWAAFVPCDTQYKDAVRQTLEQIDVIHRMCDKYPDDFKFAASSQDIMDAFEQ 134

  Fly   175 GKIASLIGVEGGHAIGTSLSVLRMFYQLGARYLTLTHTCNTPWADCCKVDEPGKYPHIGGLSQFG 239
            .|.||||||||||:|.:||..||..||||.|||||||:|||||||...:|.........|||:||
Zfish   135 NKTASLIGVEGGHSIDSSLGTLRTMYQLGVRYLTLTHSCNTPWADNWLMDTESNPVRNIGLSEFG 199

  Fly   240 KLVVKEMNRLGMIVDLSHVSVPTMLDALAASRAPLIFSHSSAHAICNSSRNVPDHVLQRIAINGG 304
            |.||.||||:||::||||||...|...|..|:||:|||||||::||...|||||.||.::..|.|
Zfish   200 KQVVWEMNRIGMLIDLSHVSEKVMNQVLDISKAPIIFSHSSAYSICKHKRNVPDDVLVKVKTNRG 264

  Fly   305 LVMVAFYPHFVSCSGQATLHDVVAHINHIREVAGIDHVGIGAGYDGVNLVPKGLEDVSKYPHLFA 369
            :|||.|:..:|:|:..|||.||..|.:||::||....:|.|..||||..||.|||||||||.|..
Zfish   265 IVMVNFFNDYVTCNEHATLSDVADHFDHIKKVADASIIGFGGDYDGVPRVPVGLEDVSKYPDLVV 329

  Fly   370 ALLESDKWSEEDIAKLAGRNLIRVFKEVEAVRDQMELLRVAPIDQSIPAEDIMGRSYCR 428
            .||... ||:.:|....||||:|||::||.|||  .|....|.|:.||.:::  ::.||
Zfish   330 ELLRRG-WSDNEIKDALGRNLLRVFRDVENVRD--SLRNTKPDDKPIPLKEV--QNPCR 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6154NP_651471.2 Peptidase_M19 61..396 CDD:279569 170/335 (51%)
dpep1NP_001307047.1 Peptidase_M19 31..355 CDD:279569 170/335 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106006723
eggNOG 1 0.900 E1_COG2355
Hieranoid 1 1.000
Homologene 1 1.000 H80192
Inparanoid 1 1.050 349 1.000 Inparanoid score I2227
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1272387at2759
OrthoFinder 1 1.000 FOG0000983
OrthoInspector 1 1.000 T597289
orthoMCL 1 0.900 OOG5_128396
Panther 1 1.100 O PTHR10443
Phylome 1 0.910 0.873 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R335
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.