DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6154 and Dpep3

Sequence 1:NP_651471.2 Gene:CG6154 FlyBaseID:FBgn0039420 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_082236.1 Gene:Dpep3 MGIID:1919104 Length:493 Species:Mus musculus

Alignment Length:388 Identity:177/389 (46%)
Similarity:243/389 (62%) Gaps:21/389 (5%)


  Fly    34 AGAASSASGGGSKTADDFDFRMQRVRN----VLKEVPLIDGHNDLPWNIRKFLKNQLKDFHFGGD 94
            |..|::|.|..:.||........|:|.    ::::.||:|||||||..:|:..:|||:|.:....
Mouse    53 ASNATTAPGIPNDTATSGVTSDPRLREQALALMRDFPLVDGHNDLPLLLRELFQNQLQDVNLRNF 117

  Fly    95 LRELAPWSSSAWSHTDLRRLKEGMVSAQFWSAYAPCSSQHLDAVQLTLEQIDLIRRLVQLYPHHM 159
            .|          ..|:|.||::|:|.|||||||.||.:|..|||:|.|||||||||:...|| .:
Mouse   118 TR----------GQTNLDRLRDGLVGAQFWSAYIPCQTQDRDAVRLALEQIDLIRRMCSAYP-EL 171

  Fly   160 ALVTTASGIEQTHRTGKIASLIGVEGGHAIGTSLSVLRMFYQLGARYLTLTHTCNTPWADCCKVD 224
            .|||:|.|:..|.   |:|.||||||||::.|||:|||.||:||.||||||.||:||||:.....
Mouse   172 ELVTSADGLNNTQ---KLACLIGVEGGHSLDTSLAVLRSFYELGVRYLTLTFTCSTPWAESATKF 233

  Fly   225 EPGKYPHIGGLSQFGKLVVKEMNRLGMIVDLSHVSVPTMLDALAASRAPLIFSHSSAHAICNSSR 289
            ....|.:|.||:.||:.||:|||||||::||||.|...:...|..|:||:|||||:|.::|::..
Mouse   234 RHHFYTNISGLTSFGEKVVEEMNRLGMMIDLSHASDTLVKQTLEVSQAPVIFSHSAARSVCDNLL 298

  Fly   290 NVPDHVLQRIAINGGLVMVAFYPHFVSCSGQATLHDVVAHINHIREVAGIDHVGIGAGYDGVNLV 354
            |:||.:||.:..|||:|||......:.||..|.:..|..|.:|||.|.|.:.:|||..|||....
Mouse   299 NIPDDILQLLKKNGGIVMVTLSMGVLQCSLFANVSTVADHFDHIRTVIGSEFIGIGGSYDGSGRF 363

  Fly   355 PKGLEDVSKYPHLFAALLESDKWSEEDIAKLAGRNLIRVFKEVEAVRDQMELLRVAPIDQSIP 417
            |:||||||.||.|...|| |..|.|.::..:...||:|||::||.||::.  |..:|::...|
Mouse   364 PQGLEDVSTYPVLIEELL-SRGWDERELQGVLRGNLLRVFRQVEQVREKS--LGQSPVEVKFP 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6154NP_651471.2 Peptidase_M19 61..396 CDD:279569 162/335 (48%)
Dpep3NP_082236.1 Peptidase_M19 83..404 CDD:279569 162/336 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106004402
eggNOG 1 0.900 E1_COG2355
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1272387at2759
OrthoFinder 1 1.000 FOG0000983
OrthoInspector 1 1.000 T131014
orthoMCL 1 0.900 OOG5_128396
Panther 1 1.100 O PTHR10443
Phylome 1 0.910 0.873 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.710

Return to query results.
Submit another query.