DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6154 and Dpep1

Sequence 1:NP_651471.2 Gene:CG6154 FlyBaseID:FBgn0039420 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_031902.2 Gene:Dpep1 MGIID:94917 Length:410 Species:Mus musculus

Alignment Length:379 Identity:197/380 (52%)
Similarity:247/380 (65%) Gaps:16/380 (4%)


  Fly    53 FRMQRVRNVLKEVPLIDGHNDLPWNIRKFLKNQLKDFHFGGDLRELAPWSSSAWSHTDLRRLKEG 117
            ||.|.|. :::..|:|||||||||.:.....|||        ||..|..:..|.:||::.:||.|
Mouse    19 FRDQAVA-IMRTTPVIDGHNDLPWQLLNLFNNQL--------LRPDADLNKLAQTHTNIPKLKAG 74

  Fly   118 MVSAQFWSAYAPCSSQHLDAVQLTLEQIDLIRRLVQLYPHHMALVTTASGIEQTHRTGKIASLIG 182
            .|..||||||.||.:|:.|||:..|||:|:|.|:.||||.....||.:|.|.|..|.||:|||||
Mouse    75 FVGGQFWSAYMPCDTQNKDAVKRILEQMDVIHRMCQLYPETFMCVTNSSDILQAFRRGKVASLIG 139

  Fly   183 VEGGHAIGTSLSVLRMFYQLGARYLTLTHTCNTPWADCCKVDEPGKYPHIGGLSQFGKLVVKEMN 247
            |||||.|.:||.|||..|.||.|||||||.|||||||...||.........|||.|||.::.|||
Mouse   140 VEGGHLIDSSLGVLRTLYHLGMRYLTLTHNCNTPWADNWLVDRGDDEAESHGLSPFGKRLLNEMN 204

  Fly   248 RLGMIVDLSHVSVPTMLDALAASRAPLIFSHSSAHAICNSSRNVPDHVLQRIAINGGLVMVAFYP 312
            |||:::|||||||.||.|||..||||:|||||||:::|...|||||.|||.:.....||||.|:.
Mouse   205 RLGVMIDLSHVSVATMKDALQISRAPVIFSHSSAYSLCPHRRNVPDDVLQLVKNTSSLVMVNFFS 269

  Fly   313 HFVSCSGQATLHDVVAHINHIREVAGIDHVGIGAGYDGVNLVPKGLEDVSKYPHLFAALLESDKW 377
            :|||||..|||..|..|::||::|||...||:|..||||.::|.|||||||||.|.|.||..: |
Mouse   270 NFVSCSDSATLPQVADHLDHIKKVAGAGAVGLGGDYDGVTMLPVGLEDVSKYPDLIAELLRRN-W 333

  Fly   378 SEEDIAKLAGRNLIRVFKEVEAVRDQMELLRVAPIDQSIPAEDIMG--RSYCRY 429
            :|.::..|...||||||.|||.|.:.|:    :|.:..|..:::.|  |:|..|
Mouse   334 TETEVRGLLADNLIRVFSEVELVSNNMQ----SPEEVPITLKELDGSCRTYYGY 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6154NP_651471.2 Peptidase_M19 61..396 CDD:279569 182/335 (54%)
Dpep1NP_031902.2 Peptidase_M19 25..352 CDD:279569 182/337 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106007565
eggNOG 1 0.900 E1_COG2355
Hieranoid 1 1.000
Homologene 1 1.000 H80192
Inparanoid 1 1.050 363 1.000 Inparanoid score I2163
Isobase 1 0.950 0 Normalized mean entropy S6062
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000983
OrthoInspector 1 1.000 T616449
orthoMCL 1 0.900 OOG5_128396
Panther 1 1.100 O PTHR10443
Phylome 1 0.910 0.873 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R335
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.