DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31086 and Traip

Sequence 1:NP_001247312.1 Gene:CG31086 FlyBaseID:FBgn0051086 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_035764.2 Gene:Traip MGIID:1096377 Length:470 Species:Mus musculus

Alignment Length:67 Identity:13/68 (19%)
Similarity:21/68 (31%) Gaps:16/68 (24%)


  Fly    97 DGETLYAGRGYHAGSLTVG-KVHPSHGC---------------LYIPYDSEEVKIFAYEVLSRRL 145
            |...::.|..:|...|... :..||..|               |:.....||..:...|.|...|
Mouse    19 DVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKKTIINKLFFDLAQEEENVLDAEFLKNEL 83

  Fly   146 EA 147
            ::
Mouse    84 DS 85

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31086NP_001247312.1 DM9 3..73 CDD:128937
DUF3421 24..134 CDD:288732 10/53 (19%)
DM9 74..143 CDD:128937 12/62 (19%)
TraipNP_035764.2 zf-RING_2 7..50 CDD:290367 7/31 (23%)
BRE1 204..>271 CDD:285810
Interaction with CYLD. {ECO:0000250} 211..470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001331
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.