DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14556 and CG15468

DIOPT Version :9

Sequence 1:NP_651464.2 Gene:CG14556 / 43176 FlyBaseID:FBgn0039413 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_572200.2 Gene:CG15468 / 31426 FlyBaseID:FBgn0061196 Length:346 Species:Drosophila melanogaster


Alignment Length:337 Identity:79/337 - (23%)
Similarity:150/337 - (44%) Gaps:73/337 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ENVKSLGEIAKCAKMPLNEMDLISR-TSKC---------------GKSVLEIFDVDEKVSFSYDG 52
            |:...|.::..|.|..|.::|:|:| |:||               |.|:..:.|.:|..|     
  Fly    21 EDFHLLRDLGDCHKANLADIDIIARTTTKCQLGGEQMISPGYQRLGPSLDRVPDDEETDS----- 80

  Fly    53 GEEEEMDIL-----DRSEQSDD--RPVKMAHDIDCLIRQIELMQIAIRKRQVKKCSEEISEETAE 110
             :||||:||     :....:|:  :.:.....:|.::::|::::..:|:.|.   .|:||:.:..
  Fly    81 -QEEEMEILPCGMGEEGITTDEETKTLITIQGLDEILKRIDILRSQLRRNQQ---LEDISQPSVM 141

  Fly   111 IEIEAGAQVKCKQRKNQGIDIKIKEKSVAICPNNQPLCGNELLEARSLRQAHNRIQLQIDELICR 175
            .|    ..:.|     .|::.|..                   |.|.:::|.:.||.|:.||:||
  Fly   142 PE----DPISC-----SGLNAKQS-------------------EIRCIQRAQHHIQCQLTELLCR 178

  Fly   176 YRKLREIIHQMRERIRCMEGNLIDLNSEAVKYVAWSSEVSKELKLCQERYNYLVNAKMSKADAKK 240
            |..||.::..:.|...|:|..:.|:..:...::||:.|.:.:|..||:|:..|...|::|..|..
  Fly   179 YDALRNMLRSLGETWTCLERRIADIRGQNRVHLAWTEECANDLSNCQQRHRSLAAVKLTKKMALL 243

  Fly   241 LDHAHTTRFLKQNAACLSKSRLKREIADFNGEVKDLVNLMSELHKELDRNM-----------AVF 294
            :...:.:...:.:...|..:.:.|.|.||..|:.:|..|..|:..|:|..:           .||
  Fly   244 VTKTNMSSGFRYSRRYLRHALIARHINDFRYEIAELKVLSEEIFSEIDGRLDQIKMKAQRFGVVF 308

  Fly   295 ES--RHSNFLDD 304
            .:  |.||.:.|
  Fly   309 STTPRQSNLIAD 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14556NP_651464.2 DUF4763 <153..297 CDD:292582 41/156 (26%)
CG15468NP_572200.2 DUF4763 73..290 CDD:406386 58/253 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460440
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019732
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.