DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14556 and CG15468

DIOPT Version :8

Sequence 1:NP_651464.2 Gene:CG14556 / 43176 FlyBaseID:FBgn0039413 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_572200.1 Gene:CG15468 / 31426 FlyBaseID:FBgn0061196 Length:290 Species:Drosophila melanogaster

Alignment Length:294 Identity:68/295 (23%)
Similarity:132/295 (45%) Gaps:57/295 (19%)


  Fly    31 KCGKSVLEIFDVDEKVSFSYDGGEEEEMDIL-----DRSEQSDD--RPVKMAHDIDCLIRQIELM 88
            :.|.|:..:.|.:|..|      :||||:||     :....:|:  :.:.....:|.::::|:::
  Fly     8 RLGPSLDRVPDDEETDS------QEEEMEILPCGMGEEGITTDEETKTLITIQGLDEILKRIDIL 66

  Fly    89 QIAIRKRQVKKCSEEISEETAEIEIEAGAQVKCKQRKNQGIDIKIKEKSVAICPNNQPLCGNELL 153
            :..:|:.|.   .|:||:.:...|    ..:.|     .|::.|..                   
  Fly    67 RSQLRRNQQ---LEDISQPSVMPE----DPISC-----SGLNAKQS------------------- 100

  Fly   154 EARSLRQAHNRIQLQIDELICRYRKLREIIHQMRERIRCMEGNLIDLNSEAVKYVAWSSEVSKEL 218
            |.|.:::|.:.||.|:.||:|||..||.::..:.|...|:|..:.|:..:...::||:.|.:.:|
  Fly   101 EIRCIQRAQHHIQCQLTELLCRYDALRNMLRSLGETWTCLERRIADIRGQNRVHLAWTEECANDL 165

  Fly   219 KLCQERYNYLVNAKMSKADAKKLDHAHTTRFLKQNAACLSKSRLKREIADFNGEVKDLVNLMSEL 283
            ..||:|:..|...|::|..|..:...:.:...:.:...|..:.:.|.|.||..|:.:|..|..|:
  Fly   166 SNCQQRHRSLAAVKLTKKMALLVTKTNMSSGFRYSRRYLRHALIARHINDFRYEIAELKVLSEEI 230

  Fly   284 HKELDRNM-----------AVFES--RHSNFLDD 304
            ..|:|..:           .||.:  |.||.:.|
  Fly   231 FSEIDGRLDQIKMKAQRFGVVFSTTPRQSNLIAD 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14556NP_651464.2 DUF4763 <153..297 CDD:292582 41/157 (26%)
CG15468NP_572200.1 DUF4763 16..242 CDD:292582 60/263 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141047654
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.