DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14544 and AT5G14600

Sequence 1:NP_001303484.1 Gene:CG14544 FlyBaseID:FBgn0039407 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_568302.1 Gene:AT5G14600 AraportID:AT5G14600 Length:318 Species:Arabidopsis thaliana

Alignment Length:326 Identity:137/327 (42%)
Similarity:181/327 (55%) Gaps:46/327 (14%)


  Fly     7 KTHIEKGDVVILYLSVSSMHAIEAVPEIVNKKGETIPHIFQTNYGSLKVENIIGVEYGSKVELSK 71
            |..||.||:||:|.....|..::     |:|.|     :.|..:|..|..:.||...|:||..:|
plant    13 KRCIEDGDLVIVYERHDVMKPVK-----VSKDG-----VLQNRFGVYKHSDWIGKPLGTKVFSNK 67

  Fly    72 G-WAHVLQPTPELWTQTLPHRTQIIYTPDISMIIHQLEVRPGAVVVESGTGSGSLSHYFLRALKP 135
            | :.::|.|||||||..|.|||||:|..|||.::..|||.||.||:||||||||||....||:.|
plant    68 GKFVYLLAPTPELWTLVLSHRTQILYIADISFVVMYLEVVPGCVVLESGTGSGSLSTSLARAVAP 132

  Fly   136 TGHLHTFDFHEARADQARDEFRRHGIADFVTVYHRDVCNLGFGAELDGKADAVFLDLPAPDLAVP 200
            |||:::|||||.||..||::|.:.||:..|||..||:...||..:|.|.||:||||||.|.||||
plant   133 TGHVYSFDFHEQRAVSAREDFEKTGISSLVTVEVRDIQGEGFPEKLSGLADSVFLDLPQPWLAVP 197

  Fly   201 HAFKALKLSGGRFCSFSPCIEQSQR-CIQELTKLGFNEIVSLEVLQQENVVKTRTLPVIDLEFLK 264
            .|.|.|| ..|..|||||||||.|| |  |:.:..|.||.:.|||       .||..|.:::.  
plant   198 SAAKMLK-QDGVLCSFSPCIEQVQRTC--EVLRSDFIEIRTFEVL-------LRTYEVKEVKM-- 250

  Fly   265 LPKTDETTAATNALESKAPKEVKKYLTSSNPQTLP--------------------GHTGFLTFAT 309
              .|......::..:::..:..|:...|:...|:.                    ||||:||||.
plant   251 --DTSSMVGESHEEDNEGMRPCKRKHRSNENDTVSQDNSSNASSVVMARPCSEARGHTGYLTFAR 313

  Fly   310 L 310
            |
plant   314 L 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14544NP_001303484.1 GCD14 72..310 CDD:285866 115/260 (44%)
AT5G14600NP_568302.1 Gcd14 16..316 CDD:225317 136/324 (42%)
GCD14 69..314 CDD:285866 114/259 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6229
Inparanoid 1 1.050 208 1.000 Inparanoid score I1235
OMA 1 1.010
OrthoDB 1 1.010 D1032689at2759
OrthoInspector 1 1.000 T193393
orthoMCL 1 0.900 OOG5_127534
Panther 1 1.100 LDO PTHR12133
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.