DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14544 and trmt61a

Sequence 1:NP_001303484.1 Gene:CG14544 FlyBaseID:FBgn0039407 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001005009.1 Gene:trmt61a XenbaseID:XB-GENE-957980 Length:303 Species:Xenopus tropicalis

Alignment Length:316 Identity:150/317 (47%)
Similarity:196/317 (62%) Gaps:24/317 (8%)


  Fly     1 MSFLKPKTHIEKGDVVILYLSVSSMHAIEAVPEIVNKKGETIPHIFQTNYGSLK-VENIIGVEYG 64
            |||::.|..||.||..|::|...||     .|..:....:|     ||.||.:: ..::||.:||
 Frog     1 MSFVEYKEFIEDGDTAIVFLGHDSM-----FPITIQNGSQT-----QTKYGVIRHSTDLIGKKYG 55

  Fly    65 SKVELSK-GWAHVLQPTPELWTQTLPHRTQIIYTPDISMIIHQLEVRPGAVVVESGTGSGSLSHY 128
            |||..|| ||.::|.|||||||..|||||||:|:.|||:|...||::||:||.|||||||||||.
 Frog    56 SKVICSKGGWVYILYPTPELWTLNLPHRTQILYSTDISLITMMLELKPGSVVCESGTGSGSLSHA 120

  Fly   129 FLRALKPTGHLHTFDFHEARADQARDEFRRHGIADFVTVYHRDVCNLGFGAELDGKADAVFLDLP 193
            .:|.:.|||||:|.:||:.||::|.:|||:|.:...|||.::|||..|||  :.|.|||||||:|
 Frog   121 IIRTVAPTGHLYTVEFHQQRAEKAIEEFRQHKVDHLVTVKNQDVCKHGFG--VTGIADAVFLDIP 183

  Fly   194 APDLAVPHAFKALKLSGGRFCSFSPCIEQSQRCIQELTKLGFNEIVSLEVLQQENVVKTRTLPVI 258
            :|..|:.||..|:|..|||.|||||||||.||....|.:.||.||.:||:|.:...|:|..|.|.
 Frog   184 SPWEAIGHAKSAMKSEGGRICSFSPCIEQVQRTCLALEEHGFTEINTLEILLRVYDVRTINLQVA 248

  Fly   259 DL-----EFLKLPKTDETTAATNALESKAPKEVKKYLTSSNPQTLPGHTGFLTFAT 309
            ||     |...|..||.|...:......|     .:.:...|:...||||:|||||
 Frog   249 DLGRAAEEKSSLDGTDRTKQISAVQHGSA-----LFKSGVPPRETVGHTGYLTFAT 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14544NP_001303484.1 GCD14 72..310 CDD:285866 123/244 (50%)
trmt61aNP_001005009.1 GCD14 64..300 CDD:312288 123/244 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C275789182
eggNOG 1 0.900 E1_COG2519
Hieranoid 1 1.000
Homologene 1 1.000 H6229
Inparanoid 1 1.050 256 1.000 Inparanoid score I2946
OMA 1 1.010
OrthoDB 1 1.010 D1032689at2759
OrthoFinder 1 1.000 FOG0003292
OrthoInspector 1 1.000 T1059848
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1550
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.