DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14544 and trmt61a

Sequence 1:NP_001303484.1 Gene:CG14544 FlyBaseID:FBgn0039407 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001002321.1 Gene:trmt61a ZFINID:ZDB-GENE-040718-5 Length:305 Species:Danio rerio

Alignment Length:316 Identity:151/317 (48%)
Similarity:203/317 (64%) Gaps:22/317 (7%)


  Fly     1 MSFLKPKTHIEKGDVVILYLSVSSMHAIEAVPEIVNKKGETIPHIFQTNYGSLK-VENIIGVEYG 64
            |||::....|::|||||:::...||     :|..|....:|     ||.||.:: ..::||..:|
Zfish     1 MSFVEYSELIQEGDVVIIFMGHDSM-----MPIKVQSGAQT-----QTRYGVIRHSSDLIGQRFG 55

  Fly    65 SKVELSK-GWAHVLQPTPELWTQTLPHRTQIIYTPDISMIIHQLEVRPGAVVVESGTGSGSLSHY 128
            |||..|| ||.:||.|||||||..|||||||:||.||:.|...||::||:||.|||||||||||.
Zfish    56 SKVTCSKGGWVYVLHPTPELWTINLPHRTQILYTTDIANITLMLELKPGSVVCESGTGSGSLSHS 120

  Fly   129 FLRALKPTGHLHTFDFHEARADQARDEFRRHGIADFVTVYHRDVCNLGFGAELDGKADAVFLDLP 193
            .||.:.|||||||.:||..||::|..||:.|.::..|||.::|||..|||  :.|.|||||||:|
Zfish   121 ILRTIAPTGHLHTVEFHSQRAEKAMQEFKEHKVSHLVTVRNQDVCKDGFG--ITGVADAVFLDIP 183

  Fly   194 APDLAVPHAFKALKLSGGRFCSFSPCIEQSQRCIQELTKLGFNEIVSLEVLQQENVVKTRTLPVI 258
            :|..|:.||.||||..|||.|||||||||.||..:.|...||.||.:||||.:.:.|:|.|||:.
Zfish   184 SPWEAISHAKKALKYKGGRLCSFSPCIEQVQRTCEALLDHGFEEICTLEVLLRVHDVRTVTLPLP 248

  Fly   259 DL---EFLKLPKTDETTAATNALESKAPKEVKKYLTSSNPQTLPGHTGFLTFATLP 311
            |.   |:..     ::|..|:.:..:.........|::.|:.:.||||:|||::.|
Zfish   249 DFGPEEYYA-----DSTQTTSDISQEDVNTSVICRTATPPREMAGHTGYLTFSSKP 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14544NP_001303484.1 GCD14 72..310 CDD:285866 124/241 (51%)
trmt61aNP_001002321.1 Gcd14 9..299 CDD:225317 147/307 (48%)
GCD14 64..298 CDD:285866 124/241 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C275793862
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6229
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1032689at2759
OrthoFinder 1 1.000 FOG0003292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127534
Panther 1 1.100 LDO PTHR12133
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.