DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14544 and Trmt61a

Sequence 1:NP_001303484.1 Gene:CG14544 FlyBaseID:FBgn0039407 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001007707.1 Gene:Trmt61a RGDID:1359191 Length:290 Species:Rattus norvegicus

Alignment Length:314 Identity:150/315 (48%)
Similarity:202/315 (64%) Gaps:27/315 (9%)


  Fly     1 MSFLKPKTHIEKGDVVILYLSVSSMHAIEAVPEIVNKKGETIPHIFQTNYGSLKVE-NIIGVEYG 64
            |||:..:..|::||..||.|...||.|:.     |.:..:|     ||.:|.|:.. ::||..:|
  Rat     1 MSFVAYEELIKEGDTAILSLGHGSMVAVR-----VQRGAQT-----QTRHGVLRHSVDLIGRPFG 55

  Fly    65 SKVELSK-GWAHVLQPTPELWTQTLPHRTQIIYTPDISMIIHQLEVRPGAVVVESGTGSGSLSHY 128
            |||..|: ||.:||.|||||||..|||||||:|:.||::|...||:|||:||.||||||||:||.
  Rat    56 SKVTCSRGGWVYVLHPTPELWTVNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHA 120

  Fly   129 FLRALKPTGHLHTFDFHEARADQARDEFRRHGIADFVTVYHRDVCNLGFGAELDGKADAVFLDLP 193
            .:|::.|||||||.:||:.|||:||:||::|.::.:|||:.:|||..|||  :...|||||||:|
  Rat   121 IIRSIAPTGHLHTVEFHQQRADKAREEFQQHRVSQWVTVHTQDVCRSGFG--VVHVADAVFLDIP 183

  Fly   194 APDLAVPHAFKALKLSGGRFCSFSPCIEQSQRCIQELTKLGFNEIVSLEVLQQENVVKTRTLPVI 258
            :|..||.||:.|||:.|||||||||||||.||..|.|...||.|:.:||||.|...|:|.:||:.
  Rat   184 SPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAAHGFTELSTLEVLPQVYNVRTVSLPLP 248

  Fly   259 DLEFLKLPKTDETTAATNALESKAPKEVKKYLTSSNPQTLPGHTGFLTFATLPP 312
            ||             ..:.||.....:...:.:.:..:...||||:|||||..|
  Rat   249 DL-------------GADDLEGNVGSDATPFRSGTPMKETVGHTGYLTFATKTP 289

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14544NP_001303484.1 GCD14 72..310 CDD:285866 124/238 (52%)
Trmt61aNP_001007707.1 Gcd14 9..290 CDD:225317 147/307 (48%)
GCD14_N 12..58 CDD:291467 19/56 (34%)
Substrate. {ECO:0000250|UniProtKB:Q96FX7} 20..22 1/2 (50%)
Substrate. {ECO:0000250|UniProtKB:Q96FX7} 35..42 4/12 (33%)
GCD14 64..287 CDD:285866 124/238 (52%)
Substrate. {ECO:0000250|UniProtKB:Q96FX7} 64..65 1/1 (100%)
Substrate. {ECO:0000250|UniProtKB:Q96FX7} 85..89 3/4 (75%)
Substrate. {ECO:0000250|UniProtKB:Q96FX7} 110..117 7/7 (100%)
S-adenosyl-L-methionine binding. {ECO:0000250|UniProtKB:Q96FX7} 114..116 2/2 (100%)
S-adenosyl-L-methionine binding. {ECO:0000250|UniProtKB:Q96FX7} 163..164 1/1 (100%)
Substrate. {ECO:0000250|UniProtKB:Q96FX7} 180..183 2/3 (67%)
Substrate. {ECO:0000250|UniProtKB:Q96FX7} 205..212 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2519
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6229
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127534
Panther 1 1.100 LDO PTHR12133
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
76.870

Return to query results.
Submit another query.