DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14544 and W02A11.1

Sequence 1:NP_001303484.1 Gene:CG14544 FlyBaseID:FBgn0039407 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_493229.1 Gene:W02A11.1 WormBaseID:WBGene00012192 Length:312 Species:Caenorhabditis elegans

Alignment Length:316 Identity:120/317 (38%)
Similarity:185/317 (58%) Gaps:18/317 (6%)


  Fly     2 SFLKPKTHIEKGDVVILYLSVSSMHAIEAVPEIVNKKGETIPHIFQTNYGSLKVENIIGVEYGSK 66
            ||:..:..|::||.||:|::...|     ||.|| |:|:|:    ...||:|:.|.|||..:|.:
 Worm     7 SFMSYEDRIQEGDTVIVYVTYGQM-----VPTIV-KRGQTL----MMKYGALRHEFIIGKRWGQR 61

  Fly    67 VELSKGWAHVLQPTPELWTQTLPHRTQIIYTPDISMIIHQLEVRPGAVVVESGTGSGSLSHYFLR 131
            :..:.|:.::|:||.:|||:.||.||||:||.|.:.|:..|:.:||:|:.|||||||||||....
 Worm    62 LSATAGYVYILRPTSDLWTRALPRRTQILYTADCAQILSLLDAKPGSVICESGTGSGSLSHAIAL 126

  Fly   132 ALKPTGHLHTFDFHEARADQARDEFRRHGIADFVTVYHRDVCNLGFGAELDGKADAVFLDLPAPD 196
            .:.|||||:|.|..|.|..:..:||:.||:....|...|:||..||  .::..||.||||:|||.
 Worm   127 TVAPTGHLYTHDIDETRTHKVLEEFKVHGLGSVTTAVVRNVCTSGF--HVENAADGVFLDVPAPW 189

  Fly   197 LAVPHAFKAL-KLSGGRFCSFSPCIEQSQRCIQELTKLGFNEIVSLEVLQQENVVKTRTLPVIDL 260
            .|:|.|.|:: :..|||..|||||:||.||....:...||..|.::|::.::..:.::....:: 
 Worm   190 EAIPFAAKSIFRARGGRLVSFSPCLEQVQRACLAMAAAGFVSIETIELVPEQKKIVSQHRQTLE- 253

  Fly   261 EFLKL----PKTDETTAATNALESKAPKEVKKYLTSSNPQTLPGHTGFLTFATLPP 312
            ||.:|    ||..:.......:|..:....:..:....|.:.|.|||:||.||:.|
 Worm   254 EFEELGDAYPKERKRNVDGTIVEQSSSAIPRITIAIVYPYSQPTHTGYLTHATMLP 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14544NP_001303484.1 GCD14 72..310 CDD:285866 95/243 (39%)
W02A11.1NP_493229.1 AdoMet_MTases 67..306 CDD:302624 94/242 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C275303182
eggNOG 1 0.900 E1_COG2519
Hieranoid 1 1.000
Homologene 1 1.000 H6229
Inparanoid 1 1.050 213 1.000 Inparanoid score I2317
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1032689at2759
OrthoFinder 1 1.000 FOG0003292
OrthoInspector 1 1.000 T475273
orthoMCL 1 0.900 OOG5_127534
Panther 1 1.100 LDO PTHR12133
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1550
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.