DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps2 and Chmp3

DIOPT Version :8

Sequence 1:NP_651455.1 Gene:Vps2 / 43164 FlyBaseID:FBgn0039402 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_758834.1 Gene:Chmp3 / 282834 RGDID:708556 Length:223 Species:Rattus norvegicus

Alignment Length:256 Identity:61/257 (24%)
Similarity:118/257 (46%) Gaps:41/257 (16%)


  Fly     4 LFGK--KISPDEMLRKNQRALNKAMRDLDRERMKMEQQEKKIIADIKKMAKEGQMDAVKIMAKDL 66
            ||||  :..|.|::.:....:.|.||.:||:...::::|:|:...:|..||:||.:...::||::
  Rat     3 LFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKEVCVVLAKEM 67

  Fly    67 VRTRRYAKKFMLMKANIQAVSLKIQTLKSQNTMAQAMKGVTKAMQNMNRQLNLPQIQKILQDFEK 131
            :|:|:...|....||::.:|.:.::...:...:|.:::..|:.|:.|...:.:|:||..:::..|
  Rat    68 IRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSK 132

  Fly   132 QSEMMDMKEEMINDAIDDAMEDEGDEEETDAVVSQVLDELGLQLGEQLGDLPSASGSLSIAGGAG 196
            :.    ||..:|.:.::|..|...|:||.:......:|.:..::               .||..|
  Rat   133 EM----MKAGIIEEMLEDTFESMDDQEEMEEAAEMEIDRILFEI---------------TAGALG 178

  Fly   197 AQKAQAVAAGGVGGGGAAGGGGASGGGAGGPGAPGGSGASSPMSDADADL---QARLDKLR 254
              ||.:.....:.....||...||.|..               .|.:.||   |:||..||
  Rat   179 --KAPSKVTDALPEPEPAGAMAASEGDE---------------EDDEEDLEAMQSRLATLR 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps2NP_651455.1 Snf7 17..185 CDD:281366 37/168 (22%)
Chmp3NP_758834.1 Intramolecular interaction with C-terminus. {ECO:0000250} 2..113 29/110 (26%)
Snf7 18..187 CDD:281366 42/190 (22%)
Important for autoinhibitory function. {ECO:0000250} 59..64 0/5 (0%)
Interaction with VPS4A. {ECO:0000250} 151..223 22/105 (21%)
Intramolecular interaction with N-terminus. {ECO:0000250} 151..221 20/102 (20%)
Important for autoinhibitory function. {ECO:0000250} 168..169 0/1 (0%)
Interaction with STAMBP. {ECO:0000250} 196..223 11/43 (26%)
MIT-interacting motif. {ECO:0000250} 201..212 4/26 (15%)
Interaction with STAMBP 204..208 1/19 (5%)
Interaction with STAMBP 222..223 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.