DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m8-HLH and Bhlhe40

DIOPT Version :10

Sequence 1:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_035628.1 Gene:Bhlhe40 / 20893 MGIID:1097714 Length:411 Species:Mus musculus


Alignment Length:223 Identity:48/223 - (21%)
Similarity:81/223 - (36%) Gaps:67/223 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEYTTKTQIYQ---------------KVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMD 50
            |::....|:|:               |:...::|::||.|:|:|:..||.|:.|      .|::.
Mouse    28 MDFAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPE------HLKLT 86

  Fly    51 KAEMLESAVIFMRQQKTPKKVA-----QEEQSLPLDS------------------FKNGYMNAVN 92
            ....||.||:.....|..|.:.     |:::.:.|.|                  |.:|:.....
Mouse    87 TLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGDLSGRNLEAGQEMFCSGFQTCAR 151

  Fly    93 EVSRVMASTPGMSVDLGKS-VMTHLGRVYKNLQQFHEAQSAADFIQNSMDCSSMDK--------- 147
            ||.:.:|.... :.||..| ::|||.||...|.|...::...|....::|......         
Mouse   152 EVLQYLAKHEN-TRDLKSSQLVTHLHRVVSELLQGGASRKPLDSAPKAVDLKEKPSFLAKGSEGP 215

  Fly   148 ------------APLSPASSGYHSDCDS 163
                        ||.....||..:|.||
Mouse   216 GKNCVPVIQRTFAPSGGEQSGSDTDTDS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m8-HLHNP_524513.1 bHLH-O_ESM5_like 12..70 CDD:381486 17/57 (30%)
ORANGE 81..125 CDD:128787 15/62 (24%)
Bhlhe40NP_035628.1 Essential for interaction with BMAL1, E-box binding and repressor activity against the CLOCK-BMAL1 heterodimer. /evidence=ECO:0000250 1..139 24/116 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
bHLH-O_DEC1 40..129 CDD:381592 21/94 (22%)
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000250 75..79 2/3 (67%)
ORANGE 140..184 CDD:128787 14/44 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..294 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.