DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mbeta-HLH and LOC116412194

DIOPT Version :9

Sequence 1:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_031761713.1 Gene:LOC116412194 / 116412194 -ID:- Length:155 Species:Xenopus tropicalis


Alignment Length:192 Identity:46/192 - (23%)
Similarity:76/192 - (39%) Gaps:58/192 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHI-TRLEKADILELTVEHMKKLRA 72
            |....||:.||::|:.||.|||..:::|:.::.:  ..|..|: ::.|||||||:.|..:::..|
 Frog    17 KAQGIRKMRKPVVEKMRRDRINSSIEQLRMLLEK--EFESHHLPSKPEKADILEMAVSFLQQHMA 79

  Fly    73 QKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLN 137
            .|..:.|.|                                             |:..|..:..:
 Frog    80 TKYAQSSLV---------------------------------------------QIEGHSKYHQD 99

  Fly   138 YLQVVVPSLPIGVP---LQAPVEDQAM-VTPPPSECDSLESGACSPAPSEASSTSGPMWRPW 195
            .||.|.|......|   |....||.:: |:||.|......:...:|.||:.      :|||:
 Frog   100 SLQFVSPKNQSEFPEKLLHNFYEDHSVAVSPPLSPLYQTPTKCTTPGPSKV------IWRPF 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 22/62 (35%)
ORANGE 97..141 CDD:128787 3/43 (7%)
LOC116412194XP_031761713.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.