DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and hes5.2

DIOPT Version :10

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001037974.1 Gene:hes5.2 / 733755 XenbaseID:XB-GENE-876635 Length:158 Species:Xenopus tropicalis


Alignment Length:40 Identity:16/40 - (40%)
Similarity:22/40 - (55%) Gaps:7/40 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 KMKKILR-KSKANAN----GATDGEKNHSDKEDKSIKLES 312
            ||.|.|: |.|.|.:    |.|.| :.|..|:|.| ||::
 Frog   178 KMPKALKPKKKKNISHDTFGTTYG-RIHMQKQDLS-KLQT 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584
ORANGE 91..135 CDD:128787
hes5.2NP_001037974.1 bHLH-O_HES5 20..77 CDD:381467
ORANGE 90..128 CDD:128787
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.