DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and Hes1

DIOPT Version :10

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_077336.3 Gene:Hes1 / 29577 RGDID:62081 Length:281 Species:Rattus norvegicus


Alignment Length:126 Identity:51/126 - (40%)
Similarity:77/126 - (61%) Gaps:6/126 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TKTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQ 74
            |.::| ||.:||::|::||||:|..|.:||.||:|.:.....:.||||||||||:||.:|:..|:
  Rat    30 TASEH-RKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQR 93

  Fly    75 QRVANPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQ 135
            .::....|..|..  |.|:|||:::...||:...||..|::.:..|.|   |||....|.|
  Rat    94 AQMTAALSTDPSV--LGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRL---LGHLANCMTQ 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 32/66 (48%)
ORANGE 91..135 CDD:128787 15/43 (35%)
Hes1NP_077336.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 6/14 (43%)
bHLH-O_HES1_4 33..95 CDD:381465 31/62 (50%)
Hairy_orange 109..148 CDD:462193 14/41 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..206
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..281
WRPW motif 276..279
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.