DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and Hey2

DIOPT Version :10

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_038932.1 Gene:Hey2 / 15214 MGIID:1341884 Length:339 Species:Mus musculus


Alignment Length:113 Identity:36/113 - (31%)
Similarity:59/113 - (52%) Gaps:10/113 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANP 80
            ||..:.::|::||.|:|..|.||:.|:....:.||.  :|||||:||::||::||  ..|.....
Mouse    49 RKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGS--AKLEKAEILQMTVDHLK--MLQATGGK 109

  Fly    81 QSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLD------LKFGTHL 122
            .......:..|....|:.:...||:...|:|.|||      ::..:||
Mouse   110 GYFDAHALATDFMSIGFRECLTEVARYLSSVEGLDPSDPLRVRLVSHL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 25/60 (42%)
ORANGE 91..135 CDD:128787 11/38 (29%)
Hey2NP_038932.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 2/2 (100%)
bHLH-O_HEY2 40..121 CDD:381490 25/75 (33%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000269|PubMed:11486045 47..116 25/70 (36%)
ORANGE 120..165 CDD:128787 11/38 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..339
YQPW motif 329..332
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.