DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and hry

DIOPT Version :10

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_316733.4 Gene:hry / 1277284 VectorBaseID:AGAMI1_005577 Length:374 Species:Anopheles gambiae


Alignment Length:161 Identity:53/161 - (32%)
Similarity:79/161 - (49%) Gaps:27/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANP 80
            |:..||::|::||||:|..|:|||.||:|.|.....:.||||||||||:||.:|:..|:|:.|..
Mosquito    34 RRSNKPIMEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENLQRQQTAMS 98

  Fly    81 QSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLG----------HQLKDMKQ 135
            |:..|..:|  ||:||:.:.|.||.......|.:..:...||...:.          |..:...|
Mosquito    99 QATDPSVMN--KFKAGFNECAQEVGRFPELEPHVKRRLLQHLNNCINGVNKSDLPKRHHHQQQHQ 161

  Fly   136 EEEIIDMAEEPVNLADQKRSKSPREEDIHHG 166
            ::.|:               .||......||
Mosquito   162 QQHIL---------------PSPPSSPEQHG 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 32/60 (53%)
ORANGE 91..135 CDD:128787 11/53 (21%)
hryXP_316733.4 None

Return to query results.
Submit another query.