DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and hpca

DIOPT Version :10

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_012812581.2 Gene:hpca / 733559 XenbaseID:XB-GENE-491920 Length:234 Species:Xenopus tropicalis


Alignment Length:112 Identity:23/112 - (20%)
Similarity:44/112 - (39%) Gaps:23/112 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VVHPKHIANRHVGMAAMPVLQKTGIRKIPTENRNPHIKQMARNHDATPTKLVAHNYENRKMVKHL 120
            |.:|..:.|..|....:...|:..:|....|....||.: ...||     ||....:|   :.:|
 Frog    58 VEYPSSLPNISVSSEELTRAQRKDLRDKLVEQAKQHILE-PMIHD-----LVVWTQQN---LNNL 113

  Fly   121 TDKHDDEVRRKKMIIEAHQTNMEEKKFKKNMIPMSEKKTIDLIRRIE 167
            .      |:.:..|:|.|        |..::..::|:.|..::.|::
 Frog   114 I------VQPEPSILEGH--------FPLSLDTITEETTWTILLRLD 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 <80..188 CDD:444056 18/88 (20%)
hpcaXP_012812581.2 FRQ1 62..216 CDD:444056 21/108 (19%)

Return to query results.
Submit another query.