DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Ppp3r2

DIOPT Version :10

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001004025.1 Gene:Ppp3r2 / 19059 MGIID:107171 Length:179 Species:Mus musculus


Alignment Length:42 Identity:7/42 - (16%)
Similarity:15/42 - (35%) Gaps:9/42 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NYENRKMVKHLTDKHDDEVRRKKMIIEAHQTNMEEKKFKKNM 151
            |..||..:.|....|         :::.|....::..::..|
Mouse   112 NIMNRYRMSHCQSCH---------VMDGHWLFYDQPNYRGRM 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 <80..188 CDD:444056 7/42 (17%)
Ppp3r2NP_001004025.1 FRQ1 18..158 CDD:444056 7/42 (17%)
Calcineurin A binding. /evidence=ECO:0000250|UniProtKB:Q63810 131..136 1/4 (25%)

Return to query results.
Submit another query.