DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and LOC1274102

DIOPT Version :10

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_003436760.2 Gene:LOC1274102 / 1274102 VectorBaseID:AGAMI1_011051 Length:363 Species:Anopheles gambiae


Alignment Length:50 Identity:11/50 - (22%)
Similarity:22/50 - (44%) Gaps:5/50 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHY 83
            |.::.:||.:.:.....|:.....|.|::     :..|.|..|..|:.|:
Mosquito   121 RTSRTSKQSMILANGRGKSNAATAVRHQN-----HGGFHPTANHPLHHHH 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 <80..188 CDD:444056 1/3 (33%)
LOC1274102XP_003436760.2 None

Return to query results.
Submit another query.