DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MME and Nepl11

Sequence 1:NP_000893.2 Gene:MME HGNCID:7154 Length:750 Species:Homo sapiens
Sequence 2:NP_649449.1 Gene:Nepl11 FlyBaseID:FBgn0037230 Length:592 Species:Drosophila melanogaster

Alignment Length:790 Identity:152/791 (19%)
Similarity:267/791 (34%) Gaps:273/791 (35%)


Human    29 ISLSVLVLLLTIIAVTMIALYATYDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLK 93
            ||.::.||.:..||...       ||.:...::.:..:..|...:|.:.:||.||:.|.|.....
  Fly     2 ISKALAVLWIAGIAYGQ-------DDLLRVETELLSFSHNLEPYLDTSKQPCQDFYGYVCSHSAN 59

Human    94 RNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKA----LYRSCINESAIDSRGG 154
               :.||.         |...:.:||:.       |:..:...:.    .::||.:...:::..|
  Fly    60 ---LSETG---------RQRFQSLLKET-------DVAQLMDMELQLINFFKSCESGRGVEALKG 105

Human   155 EPLLKLLPDIYGWPV-------------ATENW------EQKYGASWTAEKAIAQLNSKYGKKVL 200
            ..|.:   ...|||.             .|:.|      ..:.||.:..|.::...::|      
  Fly   106 SQLYR---QSGGWPSLEPNKVNASQRTNQTQRWLGLLGYFHEVGAPYFFETSVTMQSNK------ 161

Human   201 INLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPID 265
             .|.|...|....|.:...:| |:|    :..:..||  |...|:|                   
  Fly   162 -RLVVLQPDGTRRNTLRKFEQ-RVG----EVLQSFGI--EQSRAHV------------------- 199

Human   266 ENQLALEMNKVMELEKEIANATAKPEDRNDPMLLYNKMTLAQIQNNFSLEINGKPFSWLNFTNEI 330
               .|||:..:....::|..|. ..||              |:|           ||:.||...:
  Fly   200 ---TALEVLSLERSRRDIVKAD-HVED--------------QVQ-----------FSYGNFKRIV 235

Human   331 MSTVNI---------------SITNEEDVVVYAPEYLTKLKPILTKYSARDLQN-----LMSW-- 373
            ....::               ......|.:|      .|..|.|.:|.|. |||     |::|  
  Fly   236 FGNASLIRLDWDGYFRKLLGGKTPQASDTIV------VKQLPRLVEYFAL-LQNTSMVRLLNWIW 293

Human   374 -RFIMDLVSS----LSRTYKESRNAFRKALYGTTSETATWRRCANYVN-GNMENAVGRLYVEAAF 432
             .::||:|.:    ||.||...       ||....:..|    ||.|. ..|.:.:|:.|.:   
  Fly   294 TDYLMDIVDADCHQLSETYAGD-------LYAHVVQRVT----ANRVELAQMYSELGKAYTD--- 344

Human   433 AGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEY 497
                                 .|....|:| |..:::..:.|.     ......::.|.:|:..|
  Fly   345 ---------------------QLGGSVWID-EISRQSSRQFLG-----NIMHTTLNGDERLDAAY 382

Human   498 LELNYKEDEYFENIIQNLKFSQSKQL-----KKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPA 557
            ..:.......:.|:.:..||.::::|     :::|      .:....|.||||.  |::.:    
  Fly   383 HSILLGRRSLYRNLEKLRKFQRTRRLASHSAQQVR------RYAQMFAPVNAFL--GQHNL---- 435

Human   558 GILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCM 622
                        |..|||    :::|...:......|.:....|   .|.:..|...|....||:
  Fly   436 ------------STPLNY----LLLGEFFSRSLVAAGSSSRTQG---AWRSSDSERRFAIFQQCV 481

Human   623 VYQYGNFSWDLAGGQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKLLPGLD-------- 679
                         |:..|.|:.|...:|..    ||..||..::..  :..|:..:|        
  Fly   482 -------------GKQTNAIDLLLSLLAQR----QALSAYGQWLAT--QAGLVERVDAVLAAGSS 527

Human   680 -LNHKQLFFLNFAQVWCGTYRPEYAVNSIKTD-----VHSPGNFRIIGTLQNSAEFSEAFHCRKN 738
             ::.::|||:....|.|   |.|  :.:::.|     .|:        ||:||.||.|||.||..
  Fly   528 KMSLQRLFFVTSLLVDC---RSE--LGALQQDRKRQVTHA--------TLRNSPEFLEAFRCRPG 579

Human   739 SYMNP-EKKC 747
            ..:.| :::|
  Fly   580 DVLYPQDQRC 589

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MMENP_000893.2 Stop-transfer sequence. {ECO:0000255} 16..23
M13 79..748 CDD:189000 142/741 (19%)
Nepl11NP_649449.1 GluZincin 45..589 CDD:301352 141/739 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.