DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5028 and CG7755

Sequence 1:NP_001097922.1 Gene:CG5028 FlyBaseID:FBgn0039358 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_611110.2 Gene:CG7755 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster

Alignment Length:349 Identity:111/350 (32%)
Similarity:187/350 (53%) Gaps:27/350 (8%)


  Fly    49 IPSAQYGGRHAVTMLPGGG-IGPELMGYVREIFRYCGAPIDFEVIDIDPSTEGNDDLDYAITSIK 112
            :|.::|||.:.|:::.|.. ||.:...:|..:......|::.:||:     .|.|| :| ..|:.
  Fly    45 LPKSKYGGINTVSLVTGTTIIGQQGAQFVSSLLSSSRVPVEVQVIE-----AGQDD-EY-FHSVL 102

  Fly   113 RNGVAL----KGNIETKSQSLTEVSRNVAIRNELDLYVNVVHCKSYPGIPARHHDIDVVLIRQNT 173
            ||..|:    :.:.|.|.::|       .|.|:|||||.....:|:||...|...:|:.||.||.
  Fly   103 RNRTAVHVDNQADAEAKQKAL-------KICNDLDLYVFKTRTRSFPGFKCRFPGVDIQLIGQNN 160

  Fly   174 DGEYAMLEHESVPGIVESMKVVTVENAERVARYAFEFARQNNRKKVTTIHKANIMKLSDGLFLEV 238
            .|.:..||:..|.|:||::.||:.:..::..||||:.|.:..||:||.|:||....:|||..:|.
  Fly   161 MGIFNELEYSPVEGVVEALSVVSQKGNDKYLRYAFKAAAKAGRKRVTLINKAKEWPISDGSLVEA 225

  Fly   239 ANRVHKDYPE-LEHNNMIIDNTCMQSVSNPHQFDVMNMTNLYGTIVSNVLCGLMGGAGLISGRNY 302
            |.|:|..|.: ||...|.::....:.::.|..||.:..:..|.|.:|.:..|:.|||.|.|....
  Fly   226 AQRLHCHYKDCLELELMEVEEAISRLMTEPTYFDCLFASERYATFLSAICSGVCGGANLFSAVEI 290

  Fly   303 GDHYAIFEPGTRNTGTAIAGKNIANPVA--MISASIDMLNHLGHKEHANVIQEAVYQTIVNDAIR 365
            |||:|:|:|    ..|.::..|.||..|  ::|..:|:..||||.:.|:.:...:.:| :::.||
  Fly   291 GDHHAVFKP----LQTKLSLTNYANLSAYGIVSTIVDLFQHLGHDKCADALWCELKRT-MDEGIR 350

  Fly   366 TPDIGGTNSSTDVVENILKILSAK 389
            |.:.||.::...|:.||:..|..:
  Fly   351 TKEFGGQDTGEYVICNIINQLRCR 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5028NP_001097922.1 mito_nad_idh 55..386 CDD:272942 108/339 (32%)
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 108/339 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56944516
eggNOG 1 0.900 E1_COG0473
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11835
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.