DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and PET8

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_014395.3 Gene:PET8 / 855729 SGDID:S000004948 Length:284 Species:Saccharomyces cerevisiae

Alignment Length:282 Identity:121/283 (43%)
Similarity:166/283 (59%) Gaps:31/283 (11%)


  Fly    27 FFHALVAGGVAGMVVDIALFPIDTVKTRLQSELGFWRAGGFRGIYKGLAPAAAGSAPTAALFFCT 91
            ||.:|::|..||...|:..|||||:|||||::.||:..||::|||:||..|...|||.|:|||.:
Yeast     4 FFLSLLSGAAAGTSTDLVFFPIDTIKTRLQAKGGFFANGGYKGIYRGLGSAVVASAPGASLFFIS 68

  Fly    92 YECGKQFLSSVTQTKDSPYV----------------HMAAASAAEVLACLIRVPVEIAKQRSQTL 140
            |:..|        .|..||:                ||.::|..|:.|||:|||.|:.|||:|..
Yeast    69 YDYMK--------VKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVPAEVVKQRTQVH 125

  Fly   141 QGNKQ-SGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWTPLTGFDST-P 203
            ..|.. ..||.:||....|||::.||||:.:||||||||:.|||||:||.|..|....|.... |
Yeast   126 STNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLYEYLKKTWAKANGQSQVEP 190

  Fly   204 FSVALCGAVAGGISAGLTTPLDVVKTRIMLAERESLNRRRSARRILHGIYLERGFSGLFAGFVPR 268
            :..|:||::||||:|..|||||.:|||:||.:..:     |...::..||.|.|.:..|:|..||
Yeast   191 WKGAICGSIAGGIAAATTTPLDFLKTRLMLNKTTA-----SLGSVIIRIYREEGPAVFFSGVGPR 250

  Fly   269 VLWITLGGAFFFGFYDLTTRIL 290
            .:||:.|||.|.|.|:....:|
Yeast   251 TMWISAGGAIFLGMYETVHSLL 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 36/72 (50%)
PTZ00168 25..281 CDD:185494 118/272 (43%)
Mito_carr 199..291 CDD:278578 37/94 (39%)
PET8NP_014395.3 Mito_carr 5..263 CDD:332982 117/271 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C178760740
eggNOG 1 0.900 E1_KOG0768
Hieranoid 1 1.000
Homologene 1 1.000 H6834
Inparanoid 1 1.050 221 1.000 Inparanoid score I757
Isobase 1 0.950 0 Normalized mean entropy S762
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003484
OrthoInspector 1 1.000 T1136230
orthoMCL 1 0.900 OOG5_128405
Panther 1 1.100 LDO PTHR45667
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1767
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.