DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and MME1

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_013889.1 Gene:MME1 / 855202 SGDID:S000004776 Length:368 Species:Saccharomyces cerevisiae

Alignment Length:319 Identity:101/320 (32%)
Similarity:148/320 (46%) Gaps:54/320 (17%)


  Fly    28 FHALVAGGVAGMVVDIALFPIDTVKTRLQSELG-------------FWRAGGF-RGIYKGLAPAA 78
            :|.:|:||:.|.:.|.|:..:||||||.|....             .|...|. ||:|.|...|.
Yeast    54 WHCVVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYMAAM 118

  Fly    79 AGSAPTAALFFCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIRVPVEIAKQRSQTLQGN 143
            .||.|:||:||.|||..|:.:....|..|: ..|::|....:.::..:.||.|:.|.|.| |||.
Yeast   119 LGSFPSAAIFFGTYEYTKRTMIEDWQINDT-ITHLSAGFLGDFISSFVYVPSEVLKTRLQ-LQGR 181

  Fly   144 -----KQSGLQI--LLRAYRT----EGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKL------ 191
                 .|||...  |..|.:|    ||. |.|:.|:.:|:.|::|||.:||..:|.|:.      
Yeast   182 FNNPFFQSGYNYSNLRNAIKTVIKEEGF-RSLFFGYKATLARDLPFSALQFAFYEKFRQLAFKIE 245

  Fly   192 QWTPLTGFDSTPFSVALCGAVAGGISAGLTTPLDVVKTRIMLAERESLNRR-------------- 242
            |.....|..|.|..: |.||.|||::..:|||:||||||:...:..|.:.:              
Yeast   246 QKDGRDGELSIPNEI-LTGACAGGLAGIITTPMDVVKTRVQTQQPPSQSNKSYSVTHPHVTNGRP 309

  Fly   243 ----RSARRILHGIYLERGFSGLFAGFVPRVLWITLGGAFFFGFYDLTTR-ILGATSTD 296
                .|....|..:|...|..|.|:|..||.:|.::..:.....|.:|.| :..|..||
Yeast   310 AALSNSISLSLRTVYQSEGVLGFFSGVGPRFVWTSVQSSIMLLLYQMTLRGLSNAFPTD 368

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 32/85 (38%)
PTZ00168 25..281 CDD:185494 95/302 (31%)
Mito_carr 199..291 CDD:278578 31/111 (28%)
MME1NP_013889.1 Mito_carr 51..142 CDD:278578 32/88 (36%)
Mito_carr 148..240 CDD:278578 31/95 (33%)
Mito_carr 252..363 CDD:278578 32/112 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S762
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45667
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
33.010

Return to query results.
Submit another query.